KEGG   Macaca mulatta (rhesus monkey): 708165Help
Entry
708165            CDS       T01028                                 

Gene name
THBS2, THBS1
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    708165 (THBS2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    708165 (THBS2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    708165 (THBS2)
  Cell communication
   04510 Focal adhesion
    708165 (THBS2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    708165 (THBS2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   708165 (THBS2)
  Exosomal proteins of colorectal cancer cells
   708165 (THBS2)
  Exosomal proteins of bladder cancer cells
   708165 (THBS2)
Heparan sulfate/heparin binding proteins [BR:mcc00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  708165 (THBS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1126 aa AA seqDB search
MVWGLVLLALWVWPSTQAGHQDKGTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNAEDLSKITRSMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLIYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPXXXXXXXXRLHCLPCPPRYRGSQPTGVGLEAAKTEKQVCEPEN
PCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATN
ATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKD
EVGDRCDNCPYVHNPAQIDTDSNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDG
VGDHCDNCPLVHNPDQTDMDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDND
GQGDACDHDDDNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNVPDIDDVCPE
NNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDF
SGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNS
TTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEG
KQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDEHLTH
NT seq 3381 nt NT seq  +upstreamnt  +downstreamnt
atggtctgggggctggtcctgctggctctgtgggtgtggcccagcacacaagctggtcac
caggacaaaggcacgaccttcgaccttttcagtatcagcaacatcaaccgcaagaccatt
ggcgccaagcagttccgcgggcccgaccccggcgtgccggcttaccgcttcgtgcgcttc
gactacatcccgccggtgaacgcagaggacctcagcaagatcaccaggagcatgcggcag
aaggagggcttcttcctcacggcccagctcaagcaggacggcaagtccaggggcacgctg
ctggctctggagggccccggtctctcccagaggcagttcgagatcgtctccaatggccct
gcggacacgctggacctcatctactggatcgacggcacccggcacgtggtctccctggag
gacgtgggcctggctgactcgcagtggaagaacgtcaccgtgcaggtggctggagagacc
tacagcctgcacgtgggctgcgacctcatagacagcttcgctctggacgagcccttctac
gagcacctgcaggcggaaaagagccggatgtacgtggccaaaggctcagccagagagagt
cacttcaggggtttgcttcagaatgtccacctcgtgtttgaaaactctgtggaagatatt
ctaagcaagaagggttgccagcaaggccagggagctgagatcaacgccatcagtgagaac
acggagacactgcgcctgggtccgcatgtcaccaccgagtacgtgggccccagctcggag
aggaggcctgaggtgtgcgaacgctcctgcgaggagctggggaacatggtccaggagctt
tccgggctccacgtcctcgtgaaccagctcagcgagaacctcaagagagtgtcgaacgat
aaccagtttctctgggagctcattggtggccctcctaagacaaggaacatgtcagcttgc
tggcaggatggccggttctttgcggaaaatgagacgtgggtggtggacagctgcaccacg
tgtacctgcaagaaatttaaaaccatttgccaccaaatcacctgcccgcccgcgacctgc
gccagcccgtccttcgtggaaggcgaatgctgcccctcctgcctccactcggtggacggt
gaggagggctggtctccgtgggcagagtggaccgagtgctcggtgacgtgtggctctggg
acgcagcagagaggccggtcctgtgacgtcaccagcaacacctgcttggggccctccatc
cagacacgggcttgcagcctgagcaagtgtgacacccgcatccggcaggatggcggctgg
agccactggtcaccttggtcttcatgctctgtgacctgtggagtcggcaacatcacacgc
attcgtctctgcaactccccagtgccccagatggggggcaagaattgcaaagggagtggt
cgggagaccaaagcctgccagggtgccccatgcccaatcgatggccgctggagcccctgg
tccccatggtcggcctgcactgtcacctgtgccggtgggatccgggagcgcacccgggtc
tgcaacagccctgagcctcagtacggagggaaggcctgcgtgggggacgtgcaggaacgc
cagatgtgcaacaagaggagctgccccgtggatggctgtttatccaacccctnnnnnnnn
nnnnnnnnnnnnnnccggcttcactgcctgccctgcccaccccgatacagagggagccag
cccactggggttggcctggaggcagccaagacggaaaagcaagtgtgtgagcccgaaaac
ccatgtaaggacaagacacacaactgccacaagcacgcagagtgcatctacctgggccac
ttcagcgaccccatgtacaaatgcgagtgccagacaggctacgcgggcgacgggctcatc
tgcggggaggactcggacctggacggctggcccaacctcaacctggtctgcgccaccaac
gccacctaccactgcatcaaggataactgcccccatctgccgaattctgggcaggaagac
tttgacaaggacgggattggcgatgcctgtgatgatgacgacgacaatgatggtgtgacc
gatgagaaggacaactgccagctcctcttcaatccccgccaggctgactacgacaaggat
gaggttggggaccgctgtgacaactgtccttacgtgcacaaccccgcccagatcgacaca
gacagcaacggagagggtgacgcctgctccgtggacattgacggggacgatgtcttcaat
gaacgagacaattgtccctacgtctacaacactgaccagagggacacggacggtgacggt
gtgggggatcactgtgacaactgccccctggtgcacaaccccgaccagactgacatggac
aacgaccttgtcggggaccagtgtgacaacaatgaggacatagatgacgacggccaccag
aacaaccaggacaactgcccctacatctccaacgccaaccaggccgaccacgacaacgac
ggccaaggcgacgcctgcgatcacgatgatgacaacgatggcgtccccgacgacagggac
aactgccggcttgtgttcaacccagaccaggaggacttggatggtgatggacggggtgat
atttgtaaagatgattttgacaatgacaacgtcccagatattgatgatgtgtgtcctgaa
aacaatgccatcagtgagacagacttcaggaacttccagatggtccccttggatcccaaa
gggaccacccaaattgatcccaactgggtcattcgccatcaaggcaaggagctggttcag
acggccaactcggaccctggcatcgctgtaggttttgacgagtttgggtccgtggacttc
agtggcacgttctatgtaaacactgaccgggatgacgactatgccggcttcgtctttggg
taccagtcaagcagccgcttctacgtggtgatgtggaagcaggtgacgcagacctactgg
gaggaccagccgacgcgggcctatggctactccggcgtgtccctcaaggtggtgaactcc
accacggggacgggcgagcacctgaggaacgcgctgtggcacacggggaacacaccgggg
caggtgcgaaccttatggcatgaccccaggaacattggctggaaggactacacagcctac
aggtggcacctgactcacaggcccaagactggctacatcagagtcttagtgcatgaagga
aaacaggtcatggcagactcaggacctatctatgaccaaacctacgctggcgggcggctg
ggtctatttgtcttctctcaagaaatggtctatttctcagacctcaagtacgaatgcaga
gatgaacatctaacccactag

DBGET integrated database retrieval system