KEGG   Macaca mulatta (rhesus monkey): 708165Help
Entry
708165            CDS       T01028                                 

Gene name
THBS2, THBS1
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mcc04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mcc04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:mcc04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:mcc04510]
Human Diseases; Infectious diseases; Malaria [PATH:mcc05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1126 aa AA seqDB search
MVWGLVLLALWVWPSTQAGHQDKGTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNAEDLSKITRSMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLIYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPXXXXXXXXRLHCLPCPPRYRGSQPTGVGLEAAKTEKQVCEPEN
PCKDKTHNCHKHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATN
ATYHCIKDNCPHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKD
EVGDRCDNCPYVHNPAQIDTDSNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDG
VGDHCDNCPLVHNPDQTDMDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDND
GQGDACDHDDDNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNVPDIDDVCPE
NNAISETDFRNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDF
SGTFYVNTDRDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNS
TTGTGEHLRNALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEG
KQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDEHLTH
NT seq 3381 nt NT seq  +upstreamnt  +downstreamnt
atggtctgggggctggtcctgctggctctgtgggtgtggcccagcacacaagctggtcac
caggacaaaggcacgaccttcgaccttttcagtatcagcaacatcaaccgcaagaccatt
ggcgccaagcagttccgcgggcccgaccccggcgtgccggcttaccgcttcgtgcgcttc
gactacatcccgccggtgaacgcagaggacctcagcaagatcaccaggagcatgcggcag
aaggagggcttcttcctcacggcccagctcaagcaggacggcaagtccaggggcacgctg
ctggctctggagggccccggtctctcccagaggcagttcgagatcgtctccaatggccct
gcggacacgctggacctcatctactggatcgacggcacccggcacgtggtctccctggag
gacgtgggcctggctgactcgcagtggaagaacgtcaccgtgcaggtggctggagagacc
tacagcctgcacgtgggctgcgacctcatagacagcttcgctctggacgagcccttctac
gagcacctgcaggcggaaaagagccggatgtacgtggccaaaggctcagccagagagagt
cacttcaggggtttgcttcagaatgtccacctcgtgtttgaaaactctgtggaagatatt
ctaagcaagaagggttgccagcaaggccagggagctgagatcaacgccatcagtgagaac
acggagacactgcgcctgggtccgcatgtcaccaccgagtacgtgggccccagctcggag
aggaggcctgaggtgtgcgaacgctcctgcgaggagctggggaacatggtccaggagctt
tccgggctccacgtcctcgtgaaccagctcagcgagaacctcaagagagtgtcgaacgat
aaccagtttctctgggagctcattggtggccctcctaagacaaggaacatgtcagcttgc
tggcaggatggccggttctttgcggaaaatgagacgtgggtggtggacagctgcaccacg
tgtacctgcaagaaatttaaaaccatttgccaccaaatcacctgcccgcccgcgacctgc
gccagcccgtccttcgtggaaggcgaatgctgcccctcctgcctccactcggtggacggt
gaggagggctggtctccgtgggcagagtggaccgagtgctcggtgacgtgtggctctggg
acgcagcagagaggccggtcctgtgacgtcaccagcaacacctgcttggggccctccatc
cagacacgggcttgcagcctgagcaagtgtgacacccgcatccggcaggatggcggctgg
agccactggtcaccttggtcttcatgctctgtgacctgtggagtcggcaacatcacacgc
attcgtctctgcaactccccagtgccccagatggggggcaagaattgcaaagggagtggt
cgggagaccaaagcctgccagggtgccccatgcccaatcgatggccgctggagcccctgg
tccccatggtcggcctgcactgtcacctgtgccggtgggatccgggagcgcacccgggtc
tgcaacagccctgagcctcagtacggagggaaggcctgcgtgggggacgtgcaggaacgc
cagatgtgcaacaagaggagctgccccgtggatggctgtttatccaacccctnnnnnnnn
nnnnnnnnnnnnnnccggcttcactgcctgccctgcccaccccgatacagagggagccag
cccactggggttggcctggaggcagccaagacggaaaagcaagtgtgtgagcccgaaaac
ccatgtaaggacaagacacacaactgccacaagcacgcagagtgcatctacctgggccac
ttcagcgaccccatgtacaaatgcgagtgccagacaggctacgcgggcgacgggctcatc
tgcggggaggactcggacctggacggctggcccaacctcaacctggtctgcgccaccaac
gccacctaccactgcatcaaggataactgcccccatctgccgaattctgggcaggaagac
tttgacaaggacgggattggcgatgcctgtgatgatgacgacgacaatgatggtgtgacc
gatgagaaggacaactgccagctcctcttcaatccccgccaggctgactacgacaaggat
gaggttggggaccgctgtgacaactgtccttacgtgcacaaccccgcccagatcgacaca
gacagcaacggagagggtgacgcctgctccgtggacattgacggggacgatgtcttcaat
gaacgagacaattgtccctacgtctacaacactgaccagagggacacggacggtgacggt
gtgggggatcactgtgacaactgccccctggtgcacaaccccgaccagactgacatggac
aacgaccttgtcggggaccagtgtgacaacaatgaggacatagatgacgacggccaccag
aacaaccaggacaactgcccctacatctccaacgccaaccaggccgaccacgacaacgac
ggccaaggcgacgcctgcgatcacgatgatgacaacgatggcgtccccgacgacagggac
aactgccggcttgtgttcaacccagaccaggaggacttggatggtgatggacggggtgat
atttgtaaagatgattttgacaatgacaacgtcccagatattgatgatgtgtgtcctgaa
aacaatgccatcagtgagacagacttcaggaacttccagatggtccccttggatcccaaa
gggaccacccaaattgatcccaactgggtcattcgccatcaaggcaaggagctggttcag
acggccaactcggaccctggcatcgctgtaggttttgacgagtttgggtccgtggacttc
agtggcacgttctatgtaaacactgaccgggatgacgactatgccggcttcgtctttggg
taccagtcaagcagccgcttctacgtggtgatgtggaagcaggtgacgcagacctactgg
gaggaccagccgacgcgggcctatggctactccggcgtgtccctcaaggtggtgaactcc
accacggggacgggcgagcacctgaggaacgcgctgtggcacacggggaacacaccgggg
caggtgcgaaccttatggcatgaccccaggaacattggctggaaggactacacagcctac
aggtggcacctgactcacaggcccaagactggctacatcagagtcttagtgcatgaagga
aaacaggtcatggcagactcaggacctatctatgaccaaacctacgctggcgggcggctg
ggtctatttgtcttctctcaagaaatggtctatttctcagacctcaagtacgaatgcaga
gatgaacatctaacccactag

DBGET integrated database retrieval system