KEGG   Macaca mulatta (rhesus monkey): 708314Help
Entry
708314            CDS       T01028                                 

Gene name
HDAC9
Definition
(RefSeq) histone deacetylase 9
  KO
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    708314 (HDAC9)
  Substance dependence
   05034 Alcoholism
    708314 (HDAC9)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     708314 (HDAC9)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     708314 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 955 aa AA seqDB search
MMSSPAQPDGVAGREQLLAQQRMHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVD
PVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKLQQELLAIKQ
QQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRESKRHQGAVASTEVKQKLQEF
LLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQDAK
DDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSSSS
PGSGPSSPNNGPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLPNI
TLGLPAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNS
SHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKLPRHRPLNRTQ
SAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKPARQQLDFARGSPPDVQPKRDPAT
PLRLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVG
AVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPPHTRALSVRQAPLAAVGMDGLEKH
RLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCVCGNSTTHPEHAGRIQS
IWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRILLGDDSQ
KFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVRPPGHH
AEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYISLH
RYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRLVLLSL
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgatgagctcacctgcacagcctgatggggtggctggacgagagcagctcttggctcag
caaagaatgcacagtatgatcagctcagtggatgtgaagtcagaagttcctgtgggcctg
gagcccatctcacctttagacctaaggacagacctcaggatgatgatgcccgtggtggac
cctgttgtccgtgagaagcaattgcagcaggaattacttcttatccagcagcagcaacaa
atccagaagcagctcctgatagcagagtttcagaagcagcatgagaacttgacacggcag
caccaggctcagcttcaggagcatatcaagttgcaacaggaacttctagccataaaacag
caacaagaactcctagaaaaggagcagaaactggagcagcagaggcaagaacaggaagta
gagaggcatcgcagagaacagcagcttcctcctctcagaggcaaagatagaggacgagaa
agtaagaggcaccagggggcagtggcaagtacagaagtaaagcagaagcttcaagaattc
ctattgagtaaatcagcaacgaaagacactccaactaatggaaaaaatcattccgtgagc
cgccatcccaagctctggtacacggctgcccaccacacatcattggatcaaagctctcca
cctcttagtggaacgtctccatcctacaagtatacattaccaggagcacaagatgcaaag
gatgatttcccccttcgaaaaactgcctctgagcccaacttgaaggtgcggtccaggtta
aaacagaaagtggcagagaggagaagcagccccttactcaggcggaaggatggaaatgtt
gtcacttcattcaagaagcgaatgtttgaggtgacagaatcctcagtcagtagcagttct
ccaggctctggtcccagttcaccaaacaacgggccaactggaagtgttactgaaaatgag
acttcagttttgccccctacccctcatgctgagcaaatggtttcacagcaacgcattcta
attcacgaagattccatgaacctgctaagtctttatacctctccttctttgcccaacatt
accttggggcttcccgcagtgccatcccagctcaatgcttcgaattcactcaaagaaaag
cagaagtgtgagacgcagacgcttaggcaaggtgttcctctgcctgggcagtacgggggc
agcatccctgcgtcttccagccaccctcatgttactttagagggaaagccgcccaacagc
agccaccaggctctcctgcagcatctattattgaaagaacaaatgcgacagcaaaagctt
cttgtagctggtggcgttcccttacatcctcagtctcccttggcaacaaaagagagaatt
tcacctggcattagaggtacccacaaattgccccgtcacagacccctgaaccgaacccag
tctgcacctttgcctcagagcactttggctcagctggtcattcaacagcaacaccagcaa
ttcttggagaagcagaaacaataccagcagcaaatccacatgaacaaaccagcaaggcaa
cagctcgactttgctaggggatcacctccagatgttcaaccaaagagagaccctgccacc
ccactgagactgctttcgaaatctattgaacaactgaagcaaccaggcagtcaccttgag
gaggcagaggaagagcttcagggggaccaggcgatgcaggaagacagagcgccctctagt
ggcaacagcactaggagcgacagcagtgcttgtgtggatgacacactgggacaagttggg
gctgtgaaggtcaaggaggaaccagtggacagtgatgaagatgctcagatccaggaaatg
gaatctggggagcaggctgcttttatgcaacagcccttcctggaacccccgcacacacgt
gcgctctctgtgcgccaagcgccgctggctgctgttggcatggatggattagagaaacac
cgtcttgtctccaggactcactcttcccctgctgcctctgttttacctcacccagcaatg
gaccgccccctccagcctggctctgcaactggaattgcctatgaccccttgatgctgaaa
caccagtgcgtttgtggcaattccaccacccaccctgaacatgctggacgaatacagagt
atctggtcacgactgcaagaaactgggctgctaaataaatgtgagcgaattcaaggtcga
aaagccagcctggaggaaatacagcttgttcattctgaacatcactcactgttgtatggc
accaaccccctggacggacagaagctggaccccaggatactcctaggtgatgactctcaa
aagtttttttcctcattaccttgtggtggacttggggtggacagtgacaccatttggaat
gagctgcactcgtccggtgctgcacgcatggctgttggctgtgtcatcgagctggcttcc
aaagtggcctcaggagagctgaagaatgggtttgctgttgtgaggccccctggccatcac
gctgaagaatccacagccatggggttctgcttttttaattcagttgcaattaccgccaaa
tacttgagagaccaactaaatataagcaagatattgattgtagatctggatgttcaccat
ggaaacggtacccagcaggccttttatgctgaccccagcatcctgtacatttcactccat
cgctatgatgaagggaactttttccctggcagtggagccccaaatgaggttggaacaggc
cttggagaagggtacaatataaatattgcctggacaggtggccttgatcctcccatggga
gatgttgagtaccttgaagcattcaggttggtacttctttctctctga

DBGET integrated database retrieval system