KEGG   Macaca mulatta (rhesus monkey): 708441Help
Entry
708441            CDS       T01028                                 

Definition
histone deacetylase 1-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    708441
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    708441
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    708441
 Human Diseases
  Cancers
   05200 Pathways in cancer
    708441
   05202 Transcriptional misregulation in cancers
    708441
   05203 Viral carcinogenesis
    708441
   05220 Chronic myeloid leukemia
    708441
  Neurodegenerative diseases
   05016 Huntington's disease
    708441
  Substance dependence
   05034 Alcoholism
    708441
  Infectious diseases
   05169 Epstein-Barr virus infection
    708441
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     708441
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 518 aa AA seqDB search
MVRSPGGSPPICRRPWYRPRGPSAASPGCPCPLPSSGPVSAQADWLERCPGCAAIAAGGR
ADGPTDGRDGRRARWRRRRAPGGKSVTTTTRPHKANAEEMTKYHSDDYIKFLRSIRPDNM
SEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKK
SEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY
FPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSD
SLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEI
PNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAI
PEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVK
TEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggtacggtccccgggcggctccccacccatctgtcgcagaccttggtacaggcccagg
gggccctcggcggcctctccgggctgcccttgccccctgccgagttccgggcccgtgtct
gcgcaagctgattggctggagcggtgcccgggctgcgcggctatagccgcgggcgggagg
gcggacggaccgactgacggtagggacgggaggcgagcaagatggcgcagacgcagggca
cccggaggaaagtctgttactactacgacgcgccctcacaaagccaatgctgaggagatg
accaagtaccatagtgacgactacattaaattcttgcgctccatccgtccagataacatg
tcggagtacagcaagcagatgcagagattcaacgttggtgaggactgtccagtattcgac
ggcctctttgagttctgtcagttgtctactggtggttctgtggcaagtgctgtgaaactt
aataagcagcagacggacatcgctgtgaattgggctgggggcctgcaccatgcaaagaag
tctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatcctggaactgcta
aagtatcaccagagggtgctgtatattgacattgatattcaccatggcgacggcgtggaa
gaggccttctataccacagaccgggtcatgactgtgtcctttcataagtatggagagtac
ttcccaggaactggggacctgcgggatatcggggctggaaaaggcaagtattatgctgtt
aactacccgctccgagacgggattgatgacgagtcctatgaggccattttcaagccggtc
atgtccaaagtaatggagatgttccaacctagcgcggtggtcttacagtgtggctcagac
tccctgtctggggatcggttaggttgcttcaatctaaccatcaaagggcacgccaagtgt
gtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggtggtggttacacc
attcgtaatgttgcccggtgctggacatacgagacagctgtggccctggatacggagatc
cctaatgagcttccatacaacgactactttgaatactttggaccggatttcaagctccac
atcagtccttccaatatgactaaccagaacacgaatgagtacctggagaagatcaaacag
cggctgtttgagaaccttagaatgctgccgcatgcacctggggtccaaatgcaggcgatt
cctgaggacgccatccctgaggagagtggcgatgaggacgaagaagaccctgacaagcgc
atctcgatctgctcctccgacaaacgaattgcctgtgaggaagagttctccgattctgaa
gaggagggagaggggggccgcaagaactcttccaacttcaaaaaagccaagagagtcaaa
acagaggatgaaaaagagaaagacccagaggagaagaaagaagtcacagaagaggagaaa
accaaggaggaaaagccagaagccaaaggggtcaaggaggaggtcaagttggcctga

DBGET integrated database retrieval system