KEGG   Macaca mulatta (rhesus monkey): 708441Help
Entry
708441            CDS       T01028                                 

Definition
histone deacetylase 1-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:mcc04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mcc04110]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mcc04919]
Human Diseases; Cancers; Pathways in cancer [PATH:mcc05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:mcc05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mcc05203]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mcc05220]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mcc05016]
Human Diseases; Substance dependence; Alcoholism [PATH:mcc05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mcc05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 518 aa AA seqDB search
MVRSPGGSPPICRRPWYRPRGPSAASPGCPCPLPSSGPVSAQADWLERCPGCAAIAAGGR
ADGPTDGRDGRRARWRRRRAPGGKSVTTTTRPHKANAEEMTKYHSDDYIKFLRSIRPDNM
SEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKK
SEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEY
FPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSD
SLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEI
PNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAI
PEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSEEEGEGGRKNSSNFKKAKRVK
TEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggtacggtccccgggcggctccccacccatctgtcgcagaccttggtacaggcccagg
gggccctcggcggcctctccgggctgcccttgccccctgccgagttccgggcccgtgtct
gcgcaagctgattggctggagcggtgcccgggctgcgcggctatagccgcgggcgggagg
gcggacggaccgactgacggtagggacgggaggcgagcaagatggcgcagacgcagggca
cccggaggaaagtctgttactactacgacgcgccctcacaaagccaatgctgaggagatg
accaagtaccatagtgacgactacattaaattcttgcgctccatccgtccagataacatg
tcggagtacagcaagcagatgcagagattcaacgttggtgaggactgtccagtattcgac
ggcctctttgagttctgtcagttgtctactggtggttctgtggcaagtgctgtgaaactt
aataagcagcagacggacatcgctgtgaattgggctgggggcctgcaccatgcaaagaag
tctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatcctggaactgcta
aagtatcaccagagggtgctgtatattgacattgatattcaccatggcgacggcgtggaa
gaggccttctataccacagaccgggtcatgactgtgtcctttcataagtatggagagtac
ttcccaggaactggggacctgcgggatatcggggctggaaaaggcaagtattatgctgtt
aactacccgctccgagacgggattgatgacgagtcctatgaggccattttcaagccggtc
atgtccaaagtaatggagatgttccaacctagcgcggtggtcttacagtgtggctcagac
tccctgtctggggatcggttaggttgcttcaatctaaccatcaaagggcacgccaagtgt
gtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggtggtggttacacc
attcgtaatgttgcccggtgctggacatacgagacagctgtggccctggatacggagatc
cctaatgagcttccatacaacgactactttgaatactttggaccggatttcaagctccac
atcagtccttccaatatgactaaccagaacacgaatgagtacctggagaagatcaaacag
cggctgtttgagaaccttagaatgctgccgcatgcacctggggtccaaatgcaggcgatt
cctgaggacgccatccctgaggagagtggcgatgaggacgaagaagaccctgacaagcgc
atctcgatctgctcctccgacaaacgaattgcctgtgaggaagagttctccgattctgaa
gaggagggagaggggggccgcaagaactcttccaacttcaaaaaagccaagagagtcaaa
acagaggatgaaaaagagaaagacccagaggagaagaaagaagtcacagaagaggagaaa
accaaggaggaaaagccagaagccaaaggggtcaaggaggaggtcaagttggcctga

DBGET integrated database retrieval system