KEGG   Macaca mulatta (rhesus monkey): 708520Help
Entry
708520            CDS       T01028                                 

Gene name
ADH7
Definition
alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    708520 (ADH7)
  Lipid metabolism
   00071 Fatty acid degradation
    708520 (ADH7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    708520 (ADH7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    708520 (ADH7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    708520 (ADH7)
   00982 Drug metabolism - cytochrome P450
    708520 (ADH7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    708520 (ADH7)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     708520 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 374 aa AA seqDB search
MGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVS
KFPVIVGHEATGIVESIGEGVTTVQPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITGR
GVLADGTTRFTCKGKPVYHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGY
GAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATEC
ISPKDSTKPISEVLSEMTGNNVGYTFEVIGRLETMIDALASCHMNYGTSVVVGAPPSAKM
LTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLARKFDLDQLITHVLPFKKINEGFE
LLNSGQSIRTVLTF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggtactgctggaaaagttattaaatgcaaagcagctgtgctttgggagcagaagcaa
cccttctccattgaggaaatagaagttgccccaccaaagaccaaagaagttcgcattaag
attttggccacaggaatctgtcgcacagatgaccatgtcataaaaggaacaatggtgtct
aagtttccagtgattgtgggacatgaagcaactgggattgtagaaagcattggagaagga
gtgactacagtacaaccaggtgacaaagtcatccctctctttctgccacaatgtagagaa
tgcaatgcttgccgcaacccagatggcaacctttgcattaggagcgatattactggtcgt
ggagtactggctgatggcaccaccagatttacatgcaagggcaaaccagtctatcacttc
atgaacactagtacatttactgagtacacagtggtggatgaatcttcggttgctaagatt
gatgacgcagctccccctgagaaagtctgtttaattggctgtgggttttccactggatat
ggggctgctgttaaaactggcaaggtcaaacctggttccacttgcgtcgtctttggcctg
ggaggagttggcctgtcagtcatcatgggctgtaagtcagctggtgcatctaggatcatt
gggattgacctcaacaaagacaaatttgagaaggccatggctgtaggtgccactgagtgt
atcagccccaaggactctaccaaacccatcagtgaggtgctgtcagaaatgacaggcaac
aatgtggggtacacctttgaagttattgggcgtcttgaaaccatgattgatgctctggca
tcctgccatatgaactatgggaccagcgtggtagtaggagctcctccatcagccaagatg
ctcacctacgacccgatgttgctcttcactggacgcacgtggaagggatgtgtctttgga
ggtttgaaaagcagagatgatgtcccaaaactagtgactgagttcctggcaaggaaattt
gacctggaccagttgataactcatgttttaccatttaaaaaaatcaatgaaggatttgag
ctactcaactcaggacaaagcattcgaactgtcctgacgttttga

DBGET integrated database retrieval system