KEGG   Macaca mulatta (rhesus monkey): 708717Help
Entry
708717            CDS       T01028                                 

Gene name
CREB1
Definition
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04211  Longevity regulating pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04380  Osteoclast differentiation
mcc04612  Antigen processing and presentation
mcc04668  TNF signaling pathway
mcc04710  Circadian rhythm
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04725  Cholinergic synapse
mcc04728  Dopaminergic synapse
mcc04911  Insulin secretion
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04931  Insulin resistance
mcc04934  Cushing's syndrome
mcc04962  Vasopressin-regulated water reabsorption
mcc05016  Huntington's disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05165  Human papillomavirus infection
mcc05166  HTLV-I infection
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05203  Viral carcinogenesis
mcc05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    708717 (CREB1)
   04024 cAMP signaling pathway
    708717 (CREB1)
   04022 cGMP - PKG signaling pathway
    708717 (CREB1)
   04151 PI3K-Akt signaling pathway
    708717 (CREB1)
   04152 AMPK signaling pathway
    708717 (CREB1)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    708717 (CREB1)
  Endocrine system
   04911 Insulin secretion
    708717 (CREB1)
   04922 Glucagon signaling pathway
    708717 (CREB1)
   04915 Estrogen signaling pathway
    708717 (CREB1)
   04926 Relaxin signaling pathway
    708717 (CREB1)
   04918 Thyroid hormone synthesis
    708717 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    708717 (CREB1)
   04916 Melanogenesis
    708717 (CREB1)
   04924 Renin secretion
    708717 (CREB1)
   04925 Aldosterone synthesis and secretion
    708717 (CREB1)
   04927 Cortisol synthesis and secretion
    708717 (CREB1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    708717 (CREB1)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    708717 (CREB1)
  Nervous system
   04725 Cholinergic synapse
    708717 (CREB1)
   04728 Dopaminergic synapse
    708717 (CREB1)
  Development
   04380 Osteoclast differentiation
    708717 (CREB1)
  Aging
   04211 Longevity regulating pathway - mammal
    708717 (CREB1)
  Environmental adaptation
   04710 Circadian rhythm
    708717 (CREB1)
   04713 Circadian entrainment
    708717 (CREB1)
   04714 Thermogenesis
    708717 (CREB1)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    708717 (CREB1)
   05215 Prostate cancer
    708717 (CREB1)
  Neurodegenerative diseases
   05016 Huntington's disease
    708717 (CREB1)
  Substance dependence
   05030 Cocaine addiction
    708717 (CREB1)
   05031 Amphetamine addiction
    708717 (CREB1)
   05034 Alcoholism
    708717 (CREB1)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    708717 (CREB1)
   04934 Cushing's syndrome
    708717 (CREB1)
  Infectious diseases
   05152 Tuberculosis
    708717 (CREB1)
   05166 HTLV-I infection
    708717 (CREB1)
   05161 Hepatitis B
    708717 (CREB1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    708717 (CREB1)
   05165 Human papillomavirus infection
    708717 (CREB1)
Transcription factors [BR:mcc03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    708717 (CREB1)
Mitochondrial biogenesis [BR:mcc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    708717 (CREB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf ASD2 DUF4988
Motif
Other DBs
NCBI-GeneID: 708717
NCBI-ProteinID: NP_001248049
Ensembl: ENSMMUG00000022601
UniProt: F6Z7F5
Position
12
AA seq 341 aa AA seqDB search
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaatctggagccgagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcttctgctccaactgtaactctagtacagctgcccaat
gggcagacagttcaagtccatggagtcattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaagcgaagggaaattctttcaaggaggccttcttacaggaaaattttgaatgac
ttatcttctgatgcaccaggagtgccaagaattgaagaagagaagtcggaagaggagacc
tcagcacctgccatcaccactgtaacggtgccaactccaatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagccgccactcagccgggtactacc
attctacagtatgcacagaccactgatggacagcagatcttagtgcccagcaaccaagtt
gttgttcaagctgcctctggagatgtacagacataccagattcgcacagcacccactagc
actattgcccctggagttgttatggcatcctccccagcacttcctacacagcctgctgaa
gaagcagcacgaaagagagaggttcgtctaatgaagaacagggaagcagctcgagagtgt
cgtagaaagaagaaagaatatgtgaaatgtttagaaaacagagtggcagtgcttgaaaat
caaaacaagacattgattgaggagctaaaagcacttaaggacctttactgccacaaatca
gattaa

DBGET integrated database retrieval system