KEGG   Macaca mulatta (rhesus monkey): 709062Help
Entry
709062            CDS       T01028                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase, catalytic, 2
  KO
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    709062 (G6PC2)
   00052 Galactose metabolism
    709062 (G6PC2)
   00500 Starch and sucrose metabolism
    709062 (G6PC2)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    709062 (G6PC2)
   04151 PI3K-Akt signaling pathway
    709062 (G6PC2)
   04152 AMPK signaling pathway
    709062 (G6PC2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    709062 (G6PC2)
   04922 Glucagon signaling pathway
    709062 (G6PC2)
   04920 Adipocytokine signaling pathway
    709062 (G6PC2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    709062 (G6PC2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    709062 (G6PC2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     709062 (G6PC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
12
AA seq 387 aa AA seqDB search
MAQHATKARYKNGGNQSTSAPSALCLELPLFQDGFPHRNEVLIIQHLQKDYRAYYNFLNF
MSNIGDPQNTFFIYFPLWFQLNQTVGTKMIWVAVIGDWFNLIFKWILFGHRPYWWVQETQ
IYPNHSSPCLEQFPTTCETGPGSPSGHAMGSSCVWYVMVTAALSHTVCGMDKFSITLHRL
TWSFLWSVFWLIQISVCISRVFIATHFPHQVIPGVIGGMLVAEAFEHTPGIQMASLGTYL
KTNLFLFLFALGFYLLLRLLNIDLLWSVPIAKKWCANPDWIHVDTTPFAGLVRNLGVLFG
LGFAVNSEMFLLSCRGGYSYTLSFRLLCALTSLTTLHLYHFLQIPTQEEHLFYVLSFCKS
ASIPLTLVTFIPYYVHMLMKQNGKKIQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacatgccacaaaggcacggtataaaaacggtgggaatcagagcacttcagct
ccaagtgctctatgtttagaattgcctctttttcaagatggatttcctcacaggaatgaa
gtgctcataattcagcatttgcagaaggactaccgagcttactacaattttctaaatttt
atgtccaatattggagacccccagaatacctttttcatttattttccgctttggtttcag
cttaatcagacagttggaaccaagatgatatgggtagcagtcattggggattggttcaat
cttatatttaaatggatattatttggtcatcgaccttactggtgggtccaagaaactcag
atttacccaaatcactcaagtccatgccttgaacagttccctactacatgtgaaacaggt
ccaggaagtccatctggccatgcaatgggttcgtcctgtgtctggtatgtcatggtaacc
gctgccctgagccacactgtctgtgggatggataagttctctatcactctgcacagactg
acctggtcatttctttggagtgttttttggttgattcaaatcagtgtctgcatctccaga
gtattcatagcaacacattttcctcatcaagttattcctggagtaattggtggcatgctg
gtggcagaggcctttgaacacactccaggcatccaaatggctagcctgggcacataccta
aagaccaatctcttcctcttcctgtttgcacttggtttttacctgcttcttagactgctc
aacattgacctactgtggtccgtgcccatagccaaaaagtggtgtgccaaccccgactgg
atccacgttgacaccacgccttttgctggactcgtgagaaacctcggggtcctcttcggc
ttgggctttgcagtcaactcggagatgttcctcctgagctgccgaggtggatatagctac
acactgagcttccggttgctctgtgccttgacctcattgaccacattgcacctctaccat
ttcctccagatcccgactcaggaagagcatttattttatgtgctgtctttttgtaaaagt
gcatccattcccctaactttggttactttcattccctactatgttcatatgttaatgaaa
caaaacggaaagaagattcagtag

DBGET integrated database retrieval system