KEGG   Macaca mulatta (rhesus monkey): 709062Help
Entry
709062            CDS       T01028                                 

Definition
glucose-6-phosphatase 2-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mcc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcc00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mcc04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mcc04151]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mcc04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mcc04920]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:mcc04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 186 aa AA seqDB search
MAQHATKARYKNGGNQSTSAPSALCLELPLFQDGFPHRNEVLIIQHLQKDYRAYYNFLNF
MSNIGDPQNTFFIYFPLWFQLNQTVGTKMIWVAVIGDWFNLIFKWILFGHRPYWWVQETQ
IYPNDSSPCLEQFPTTCETGPGSPSGHAMGSSCVWYVMVTAALSHTVCGMDKFSITLHRH
AGGRGL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacatgccacaaaggcacggtataaaaacggtgggaatcagagcacttcagct
ccaagtgctctatgtttagaattgcctctttttcaagatggatttcctcacaggaatgaa
gtgctcataattcagcatttgcagaaggactaccgagcttactacaattttctaaatttt
atgtccaatattggagacccccagaatacctttttcatttattttccgctttggtttcag
cttaatcagacagttggaaccaagatgatatgggtagcagtcattggggattggttcaat
cttatatttaaatggatattatttggtcatcgaccttactggtgggtccaagaaactcag
atttacccaaatgactcaagtccatgccttgaacagttccctactacatgtgaaacaggt
ccaggaagtccatctggccatgcaatgggttcgtcctgtgtctggtatgtcatggtaacc
gctgccctgagccacactgtctgtgggatggataagttctctatcactctgcacaggcat
gctggtggcagaggcctttga

DBGET integrated database retrieval system