KEGG   Macaca mulatta (rhesus monkey): 709132Help
Entry
709132            CDS       T01028                                 

Gene name
UGT2B4
Definition
(RefSeq) UDP-glucuronosyltransferase 2B30
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    709132 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    709132 (UGT2B4)
   00500 Starch and sucrose metabolism
    709132 (UGT2B4)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    709132 (UGT2B4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    709132 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    709132 (UGT2B4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    709132 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    709132 (UGT2B4)
   00983 Drug metabolism - other enzymes
    709132 (UGT2B4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    709132 (UGT2B4)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     709132 (UGT2B4)
Glycosyltransferases [BR:mcc01003]
 Others
  Hydrophobic molecule
   709132 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 279 aa AA seqDB search
MAKAEIWLIRNYWDFQFPHPLLPHVELVGGLHCKPAKPLPKEMEEFVQSSGDNGVVVFSL
GSMISNMSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTQLYKWLPQNDLLGHPKTR
AFITHGGANGIYEAIYHGIPMVGVPLFADQLDNIAHMKAKGAAVSLDFNTMSSTDLLHAL
KTVINDPLYKENAMKLSSIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAYDLTWFQYH
SLDVIGFLLACVATVIFIITKCLFFVLKFVRTGKKGKRD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagctgaaatatggctgattcgaaactactgggattttcaatttcctcaccca
ctcttaccacatgttgagttagttggaggactccactgcaaacctgccaaacccctacct
aaggaaatggaagagtttgtccagagctctggagacaatggtgttgtggtgttttctctg
gggtcgatgatcagtaacatgtcagaagaaagggccaacgtaattgcatcagcactcgcc
aagatcccacaaaaggttttgtggagatttgatgggaataaaccagataccttaggactc
aatactcagctgtacaagtggctaccccagaatgatcttcttggtcatccaaaaaccaga
gcttttataactcatggtggagccaatggcatctacgaggcgatctaccatggaattccc
atggtgggcgttccattgtttgcagatcagcttgataacattgcacacatgaaggccaag
ggcgcagctgttagtctggacttcaacacaatgtcgagtacagacttactccatgcactg
aaaacagtaattaatgaccctttatataaagagaatgctatgaaattatcaagcattcat
catgatcaaccagtgaagcccctggatcgagcagtcttctggattgaatttgtcatgcgc
cataaaggagccaaacaccttcgggttgctgcctacgacctcacctggttccagtaccac
tctttggatgtgattgggttcctgttggcctgtgtggcaactgtgattttcatcatcaca
aaatgtctgttttttgtcttgaagtttgttagaacaggaaagaagggaaaaagagattaa

DBGET integrated database retrieval system