KEGG   Macaca mulatta (rhesus monkey): 709145Help
Entry
709145            CDS       T01028                                 

Gene name
EGR3
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Hepatitis B
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mcc05203]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mcc05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 333 aa AA seqDB search
MDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVP
PASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQ
DYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAF
KDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTR
HLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKI
HLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacatcggtctgaccaacgagaagcccaacccggaactctcttactccggctccttc
cagccagcccccggcaacaagaccgtgacctacttgggaaagttcgccttcgactcccct
tccaactggtgccaggacaacatcattagcctcatgagcgccggcatcttgggggtgccc
ccggcttcaggggcgctcagcacgcagacgtccactgccagcatggtgcagccaccgcag
ggtgacgtggaggccatgtatccggcgctacccccctactccaactgcggcgacctctac
tcagagcccgtgtctttccacgatccgcagggcaaccccgggctcgcctattccccccag
gattaccaatcggccaagccggcgttggacagcaatctcttccccatgattcctgactac
aacctgtaccaccaccccaacgacatgggctctattccggagcacaagcccttccagggc
atggaccccatccgggtcaacccgccccctattacccctctggagaccatcaaggcattc
aaagacaagcagatccacccgggctttggcagcctgccccagccgccgctcaccctcaag
cccatccggccccgcaagtaccccaaccggcctagcaagaccccgctccacgaacggccc
cacgcgtgcccggccgagggctgcgaccgccgtttcagccgttcggacgagctgacccgg
cacctgcgcatccacacgggccacaagcctttccagtgccggatctgcatgcggagcttc
agccgcagcgaccacctcaccactcacatccgcactcatacgggcgagaagccctttgcc
tgcgagttctgcggtcgcaagtttgcgcgcagcgacgagcgcaagcgccacgccaagatc
cacctcaagcaaaaggagaagaaggcggagaagggcggtgcaccctctgcatcctcggcg
ccccctgtgtcgctggccccagtggtcaccacctgcgcctga

DBGET integrated database retrieval system