KEGG   Macaca mulatta (rhesus monkey): 709290Help
Entry
709290            CDS       T01028                                 

Definition
cytochrome P450 4B1-like
Orthology
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 496 aa AA seqDB search
MVPSFLSLRLSCLGLWASGLILVLGFLKLIRLLLRRQRLAKAMGNFPGPPTHWLFGHALE
IQQTGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGGRGLLVLEGPKWF
QHRKLLTPGFHYDVLKPYVALFAESTRVMLDKWEEKAQEGKSFDIFCDVGHMALNTLMKC
TFGRGDTGLGHRDSSYYLAVSDLTLLMQQRLVSFHYHNDFIYWLTPHGRRFLRACQVAHD
HTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDSKLSDADLRAEVDTFMFE
GHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDSFQWDDLGKMTYLTMCIKESFR
LYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFDPLRFSTENA
SKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLHFEFSLDPSRLPIKMLQLVLRSK
NGIHLHLKPLGPGSGK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccagcttcctctccctgagactctcctgcttgggcctgtgggcttctgggctg
atcttggtcttaggctttctcaagctcatccgcctgctgctgcggaggcagaggttggct
aaggctatgggcaacttcccagggcctccaactcactggctctttggacatgccctggag
atccagcagacggggagcctggacaaagtggtgtcctgggcccaccagttcccatatgcc
cacccactctggttcggacagttcattggcttcctgaacatctatgagcccgactatgcc
aaagctgtgtacagccgtggggggagaggcctgctagttcttgaggggcccaagtggttc
cagcaccgcaagctgctcacacctggctttcattatgatgtgctgaagccctatgtggct
ctgttcgctgagtccacacgtgtcatgctggacaagtgggaagagaaggctcaggagggt
aagtcctttgacatcttctgcgatgtgggccacatggcgctgaacacgctcatgaagtgc
acctttggaagaggagacaccggcctgggccacagggacagcagctactaccttgcagtc
agcgatctcactctgttgatgcagcagcgccttgtgtccttccactaccataatgacttc
atctactggctcaccccacatggccgccgcttcctgcgggcctgccaggtggcccatgac
catacagaccaggtcatcagggagcggaaggcagcccttcaggatgagaaggtgcggaag
aagatccagaaccggaggcacctggacttcctggacattctcctgggtgcccgggatgaa
gatgacagcaagctgtcagatgcagacctccgggctgaggtggacacattcatgtttgaa
ggccatgacaccaccaccagtggtatctcctggtttctctactgcatggccctgtaccct
gagcaccagcatcgttgtagagaggaggtccgtgagatcctgggggaccaggactccttc
cagtgggatgatctgggcaaaatgacttatctgaccatgtgcatcaaggagagcttccgc
ctctacccacctgtgccccaggtgtaccgccagctcagcaagcctgtcacctttgtggat
ggccggtctctacctgcaggaagcctgatctctatgcacatctatgccctccataggaac
agtgctgtatggcccgaccctgaggtctttgaccctctgcgcttttccactgagaatgcg
tccaaacgccatccctttgcctttatgcccttctctgctgggcccaggaactgcatcggg
cagcagtttgccatgagtgagatgaaggtggttacagccatgtgcttgctccactttgag
ttctctctggacccctcacggctgcccatcaagatgctccagcttgtcctgcgctccaag
aatggcatccacctccacctgaagccactgggccctgggtctgggaagtag

DBGET integrated database retrieval system