KEGG   Macaca mulatta (rhesus monkey): 709290Help
Entry
709290            CDS       T01028                                 

Definition
(RefSeq) cytochrome P450 4B1
  KO
K07426  
cytochrome P450, family 4, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     709290
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP4 family
   709290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 511 aa AA seqDB search
MVPSFLSLRLSCLGLWASGLILVLGFLKLIRLLLRRQRLAKAMGNFPGPPTHWLFGHALE
IQQTGSLDKVVSWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQ
WIGRGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVALFAESTRVMLDKWEEKAQEGKSFDI
FCDVGHMALNTLMKCTFGRGDTGLGHRDSSYYLAVSDLTLLMQQRLVSFHYHNDFIYWLT
PHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDSKL
SDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDSFQWDDL
GKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWP
DPEVFDPLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLHFEFSLDP
SRLPIKMLQLVLRSKNGIHLHLKPLGPGSGK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccagcttcctctccctgagactctcctgcttgggcctgtgggcttctgggctg
atcttggtcttaggctttctcaagctcatccgcctgctgctgcggaggcagaggttggct
aaggctatgggcaacttcccagggcctccaactcactggctctttggacatgccctggag
atccagcagacggggagcctggacaaagtggtgtcctgggcccaccagttcccatatgcc
cacccactctggttcggacagttcattggcttcctgaacatctatgagcccgactatgcc
aaagctgtgtacagccgtggggaccctaaggcccctgatgtgtatgacttcttcctccag
tggattgggagaggcctgctagttcttgaggggcccaagtggttccagcaccgcaagctg
ctcacacctggctttcattatgatgtgctgaagccctatgtggctctgttcgctgagtcc
acacgtgtcatgctggacaagtgggaagagaaggctcaggagggtaagtcctttgacatc
ttctgcgatgtgggccacatggcgctgaacacgctcatgaagtgcacctttggaagagga
gacaccggcctgggccacagggacagcagctactaccttgcagtcagcgatctcactctg
ttgatgcagcagcgccttgtgtccttccactaccataatgacttcatctactggctcacc
ccacatggccgccgcttcctgcgggcctgccaggtggcccatgaccatacagaccaggtc
atcagggagcggaaggcagcccttcaggatgagaaggtgcggaagaagatccagaaccgg
aggcacctggacttcctggacattctcctgggtgcccgggatgaagatgacagcaagctg
tcagatgcagacctccgggctgaggtggacacattcatgtttgaaggccatgacaccacc
accagtggtatctcctggtttctctactgcatggccctgtaccctgagcaccagcatcgt
tgtagagaggaggtccgtgagatcctgggggaccaggactccttccagtgggatgatctg
ggcaaaatgacttatctgaccatgtgcatcaaggagagcttccgcctctacccacctgtg
ccccaggtgtaccgccagctcagcaagcctgtcacctttgtggatggccggtctctacct
gcaggaagcctgatctctatgcacatctatgccctccataggaacagtgctgtatggccc
gaccctgaggtctttgaccctctgcgcttttccactgagaatgcgtccaaacgccatccc
tttgcctttatgcccttctctgctgggcccaggaactgcatcgggcagcagtttgccatg
agtgagatgaaggtggttacagccatgtgcttgctccactttgagttctctctggacccc
tcacggctgcccatcaagatgctccagcttgtcctgcgctccaagaatggcatccacctc
cacctgaagccactgggccctgggtctgggaagtag

DBGET integrated database retrieval system