KEGG   Macaca mulatta (rhesus monkey): 709355Help
Entry
709355            CDS       T01028                                 

Definition
beta-galactosidase-like
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    709355
  Lipid metabolism
   00600 Sphingolipid metabolism
    709355
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    709355
   00604 Glycosphingolipid biosynthesis - ganglio series
    709355
   00511 Other glycan degradation
    709355
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    709355
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     709355
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   709355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 373 aa AA seqDB search
MPGFLVRILPLLLPLLLLGPTRGLRNATRRVFEIAYSQDRFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNTIQTYVPWNFHESWPGQYQFSEDHDVEYFLRLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKEAILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPI
ITVQVENEYGSYFACDFDYLRFLQKRFHHHLGDDVVLFTTDGAHETFLQCGALQGLYTTV
DFGPGSNITDAFQIQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEVVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNVIQKVGAL
YELWWADLGQSLS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgccggggttcctggttcgcatcctccctctgctgctgcctctgctgcttctgggccct
acgcgcggcttgcggaatgccacccggagggtgtttgaaattgcctatagccaggaccgc
ttcctcaaggatggccagccgtttcgctacatctcaggaagcattcactactcccgcgtc
ccccgcttctactggaaggaccggctgctgaagatgaagatggctgggctgaacaccatc
cagacgtatgtgccctggaactttcatgagtcctggccaggacagtaccagttttctgag
gaccatgatgtggaatattttcttcggctggctcacgagctgggactgctggttatcctg
aggcctggaccctacatctgtgcggagtgggaaatgggaggattacctgcttggctgcta
gagaaagaggctattcttctccgctcttccgacccagattacctggcagctgtggacaag
tggttgggagtccttctgcccaagatgaagcctctcctctatcagaatggagggccaatt
ataacagtgcaggttgaaaatgaatatggcagctacttcgcctgtgattttgactacctg
cgcttcctgcagaagcgctttcaccaccatctgggggatgatgtggttctgttcaccacg
gacggcgcacatgagacgttcctgcaatgtggggccctgcagggcctctacaccacggtg
gactttggaccaggcagcaacatcacagatgctttccaaatccagaggaagtgtgagccc
aaaggacccttgatcaattctgaattctatactggctggctagaccactggggccaacct
cactccacaatcaagactgaagtggtggcttcctccctgtatgatatacttgcccgtggg
gcgagtgtgaacttgtacatgtttataggtgggaccaattttgcctattggaatggggcc
aactcaccctatgcagcccagcccaccagctacgactatgatgccccactgagtgaggcc
ggggacctcactgagaagtattttgctctgcgaaacgttatccagaaggtgggtgctttg
tatgagctgtggtgggctgatcttggacagagcctctcttga

DBGET integrated database retrieval system