KEGG   Macaca mulatta (rhesus monkey): 709490Help
Entry
709490            CDS       T01028                                 

Definition
d-beta-hydroxybutyrate dehydrogenase, mitochondrial-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mcc00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mcc00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 358 aa AA seqDB search
MLATRLSRPLSRLPGKTLSACDRENGARFLRFPALPEDSGIPGAGALPSHLGPASWTLVT
SAQLPGQVGSKAVLVTGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSD
RLRTVQLNVCSSEEVEKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVA
EVNLWGTVRTTKSFLPLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYE
MHSLGVKVSVVEPGNFIAATSLYSPESIQAIAKKMWDELPEVVRKDYGKKYFDEKIAKME
TYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIITHLPGAISDMIYIR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgctggccacccgcctctccagacccctgtcacggctcccaggaaaaaccctaagtgcc
tgtgatagagaaaatggagcaagatttctcagatttccagctttgccagaagactctggc
atccctggagcaggtgccttaccctcacatctgggacccgcctcctggactttggtcacc
agtgctcagctcccaggccaggttggcagcaaagctgtcctggtcacaggctgtgactct
ggatttgggttctcgttggccaagcatctacattcaaaaggcttccttgtgtttgctggc
tgcttgatgaaggacaaaggccatgatggggtcaaggagctggacagcctaaacagtgac
cgattgagaaccgtccagctcaacgtctgcagcagtgaagaggtggagaaagtggtggag
atcgtccgatcgagcctgaaggaccctgagaaagggatgtggggcctcgttaacaacgcc
ggcatctccacgttcggggaggtggagttcaccagcatggagacctacaaggaggtggca
gaagtgaacctttggggcacagtgcggacaacgaagtcctttctcccccttatccgaagg
gccaaaggccgcgtggtcaatatcagcagcatgctgggccgcatggccaacccggcccgc
tcgccctactgcatcaccaagtttggggtagaggctttctcagactgcctgcgctatgag
atgcactccctgggcgtgaaggtcagtgtggtggagcccggcaacttcatcgctgccacc
agcctctacagccccgagagcattcaggccatcgccaagaagatgtgggacgagctgcct
gaggtcgtgcgcaaggactacggcaagaagtactttgatgaaaagatcgccaagatggag
acctactgcagcagtggctccacagacacgtcccctgtcatcgatgctgtcacacacgcc
ctgaccgccaccaccccctacacccgctaccaccccatggactactactggtggcttcga
atgcagatcattacccacttgcctggagccatctctgacatgatctacatccgctga

DBGET integrated database retrieval system