KEGG   Macaca mulatta (rhesus monkey): 709490Help
Entry
709490            CDS       T01028                                 

Gene name
BDH1
Definition
(RefSeq) 3-hydroxybutyrate dehydrogenase, type 1
  KO
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    709490 (BDH1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    709490 (BDH1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     709490 (BDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 343 aa AA seqDB search
MLATRLSRPLSRLPGKTLSACDRENGARRPLLLGSTSFIPTGRRTYAGAVEPVGSKAVLV
TGCDSGFGFSLAKHLHSKGFLVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEV
EKVVEIVRSSLKDPEKGMWGLVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRTTKSFL
PLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHSLGVKVSVVEPGN
FIAATSLYSPESIQAIAKKMWDELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVID
AVTHALTATTPYTRYHPMDYYWWLRMQIITHLPGAISDMIYIR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctggccacccgcctctccagacccctgtcacggctcccaggaaaaaccctaagtgcc
tgtgatagagaaaatggagcaagacgcccactattgcttggttctacttcctttatcccg
actggccgtcggacttatgccggtgcagtggagccggttggcagcaaagctgtcctggtc
acaggctgtgactctggatttgggttctcgttggccaagcatctacattcaaaaggcttc
cttgtgtttgctggctgcttgatgaaggacaaaggccatgatggggtcaaggagctggac
agcctaaacagtgaccgattgagaaccgtccagctcaacgtctgcagcagtgaagaggtg
gagaaagtggtggagatcgtccgatcgagcctgaaggaccctgagaaagggatgtggggc
ctcgttaacaacgccggcatctccacgttcggggaggtggagttcaccagcatggagacc
tacaaggaggtggcagaagtgaacctttggggcacagtgcggacaacgaagtcctttctc
ccccttatccgaagggccaaaggccgcgtggtcaatatcagcagcatgctgggccgcatg
gccaacccggcccgctcgccctactgcatcaccaagtttggggtagaggctttctcagac
tgcctgcgctatgagatgcactccctgggcgtgaaggtcagtgtggtggagcccggcaac
ttcatcgctgccaccagcctctacagccccgagagcattcaggccatcgccaagaagatg
tgggacgagctgcctgaggtcgtgcgcaaggactacggcaagaagtactttgatgaaaag
atcgccaagatggagacctactgcagcagtggctccacagacacgtcccctgtcatcgat
gctgtcacacacgccctgaccgccaccaccccctacacccgctaccaccccatggactac
tactggtggcttcgaatgcagatcattacccacttgcctggagccatctctgacatgatc
tacatccgctga

DBGET integrated database retrieval system