KEGG   Macaca mulatta (rhesus monkey): 709535Help
Entry
709535            CDS       T01028                                 

Gene name
CYP4X1
Definition
(RefSeq) cytochrome P450 4X1
  KO
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    709535 (CYP4X1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     709535 (CYP4X1)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP4 family
   709535 (CYP4X1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 509 aa AA seqDB search
MEFSWLETRXARPFTCAFVFCLALGLLQTIKLYLRRQRLLRDLRAFPTPPXHWFLGHQKF
IQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFYIYDPDYAKTFLSRTDPKSQYLQKFLPPL
IGKGLLALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKTMLDKWEKICSTQNTSVEV
YEHINLMSLDIIMKCAFSKETNCQTNSTHDPYVKAIFELGKIIFHRLYSFLYHSDIIFKL
SPQGYRFQKLSRVLNQYTDAIIQERKKSLQAGEKQDNTQKRKYQDFLDIVLSAKDENGSS
FSDTDVHSEVSMFLLGGHDSLAASISWILYCLALNPEHQERCREEVRGILGDGCSITWDQ
LGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVW
KNPKVFDPLRFSQENCDQIHPYAYLPFSAGSRNCIGQQFAMIQLKVAIALILLHFRVTPD
PTRPPTFSNHFILKPKNGMYLHLKKLSEC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggaattctcctggctggagacgcgcngggcgcggccttttacctgcgcgttcgtgttc
tgcctggccctgggcttgctgcagaccattaagctctacctgcggaggcagaggctgctg
cgggacctgcgcgccttcccaacgcccccancccactggttccttgggcaccagaagttt
attcaggatgataacatggagaagcttgaggaaattattgaaaaataccctcgtgccttc
cctttctggattgggccctttcaggcatttttctatatctatgacccagactatgcaaag
acatttctgagcagaacagatcccaagtcccagtacctgcagaaattcttacctccactt
attgggaaaggactgctggctctagatggacccaagtggttccagcatcgtcgcctgcta
actcctggattccattttaacatcctgaaagcatacatcgaggtgatggctcattctgtg
aaaacgatgctggataagtgggagaagatttgcagcactcagaacacaagcgtggaggtc
tatgagcacatcaacttgatgtctctggatataatcatgaaatgcgctttcagcaaggag
accaactgccagacaaacagcacccatgatccttatgtaaaagccatatttgaactcggc
aaaatcatatttcaccgcttgtacagtttcttgtatcacagtgacataattttcaaactc
agccctcagggctaccgcttccagaagttaagccgagtgttgaatcagtacacagatgcg
ataatccaggaaagaaaaaaatccctccaggctggggaaaagcaggataacactcagaag
aggaagtaccaggattttctggatattgtcctttctgccaaggatgaaaatggtagcagc
ttctcagatactgatgtacactccgaagtgagcatgttcttgttgggaggacatgactcc
ttggcagcaagcatctcctggatcctttactgcctggctctgaaccctgagcatcaagag
agatgccgggaggaggtcaggggcatcctgggggatgggtgttctataacctgggaccag
ctgggtgagatgtcgtacaccacaatgtgcatcaaggagacgtgccgattgattcctgcc
gtcccatccatttccagagatctcagcaagccacttactttcccagatggatgcacattg
cctgcagggatcaccgtggttcttagtatttggggtcttcaccacaaccctgctgtctgg
aaaaacccaaaggtctttgaccccttgaggttctctcaggagaattgtgatcagatacac
ccctatgcctacttaccattctcagctggatcaaggaactgcattgggcagcagtttgcc
atgattcagttaaaggtggccattgctttgattctgctccactttagagtgactccagac
cccaccaggcctcctactttctccaaccactttatcctcaagcccaagaatgggatgtat
ttgcacctgaagaaactctctgaatgttag

DBGET integrated database retrieval system