KEGG   Macaca mulatta (rhesus monkey): 709535Help
Entry
709535            CDS       T01028                                 

Definition
cytochrome P450 4X1-like
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    709535
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     709535
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP4 family
   709535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 508 aa AA seqDB search
MMWGGGLDLRSMPGHLRFSLYLSRCLFWESPSLYLTQPTSSPAEPQAPMCMNSSSSGLFI
QDDNMEKLEEIIEKYPRAFPFWIGPFQAFFYIYDPDYAKTFLSRTDPKSQYLQKFLPPLI
GKGLLALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKTMLDKWEKICSTQNTSVEVY
EHINLMSLDIIMKCAFSKETNCQTNSTHDPYVKAIFELGKIIFHRLYSFLYHSDIIFKLS
PQGYRFQKLSRVLNQYTDAIIQERKKSLQAGEKQDNTQKRKYQDFLDIVLSAKDENGSSF
SDTDVHSEVSMFLLGGHDSLAASISWILYCLALNPEHQERCREEVRGILGDGCSITWDQL
GEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWK
NPKVFDPLRFSQENCDQIHPYAYLPFSAGSRNCIGQQFAMIQLKVAIALILLHFRVTPDP
TRPPTFSNHFILKPKNGMYLHLKKLSEC
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggggaggaggcctagacctgcgttctatgcctggacatctgaggttctcactt
tacttatcaaggtgcctcttctgggaatcccctagtctctatttgacccaaccaacttct
tcacctgcagagcctcaggccccaatgtgtatgaattcttcctccagtggattgtttatt
caggatgataacatggagaagcttgaggaaattattgaaaaataccctcgtgccttccct
ttctggattgggccctttcaggcatttttctatatctatgacccagactatgcaaagaca
tttctgagcagaacagatcccaagtcccagtacctgcagaaattcttacctccacttatt
gggaaaggactgctggctctagatggacccaagtggttccagcatcgtcgcctgctaact
cctggattccattttaacatcctgaaagcatacatcgaggtgatggctcattctgtgaaa
acgatgctggataagtgggagaagatttgcagcactcagaacacaagcgtggaggtctat
gagcacatcaacttgatgtctctggatataatcatgaaatgcgctttcagcaaggagacc
aactgccagacaaacagcacccatgatccttatgtaaaagccatatttgaactcggcaaa
atcatatttcaccgcttgtacagtttcttgtatcacagtgacataattttcaaactcagc
cctcagggctaccgcttccagaagttaagccgagtgttgaatcagtacacagatgcgata
atccaggaaagaaaaaaatccctccaggctggggaaaagcaggataacactcagaagagg
aagtaccaggattttctggatattgtcctttctgccaaggatgaaaatggtagcagcttc
tcagatactgatgtacactccgaagtgagcatgttcttgttgggaggacatgactccttg
gcagcaagcatctcctggatcctttactgcctggctctgaaccctgagcatcaagagaga
tgccgggaggaggtcaggggcatcctgggggatgggtgttctataacctgggaccagctg
ggtgagatgtcgtacaccacaatgtgcatcaaggagacgtgccgattgattcctgccgtc
ccatccatttccagagatctcagcaagccacttactttcccagatggatgcacattgcct
gcagggatcaccgtggttcttagtatttggggtcttcaccacaaccctgctgtctggaaa
aacccaaaggtctttgaccccttgaggttctctcaggagaattgtgatcagatacacccc
tatgcctacttaccattctcagctggatcaaggaactgcattgggcagcagtttgccatg
attcagttaaaggtggccattgctttgattctgctccactttagagtgactccagacccc
accaggcctcctactttctccaaccactttatcctcaagcccaagaatgggatgtatttg
cacctgaagaaactctctgaatgttag

DBGET integrated database retrieval system