KEGG   Macaca mulatta (rhesus monkey): 709716Help
Entry
709716            CDS       T01028                                 

Gene name
PDIA4
Definition
protein disulfide-isomerase A4-like
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    709716 (PDIA4)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    709716 (PDIA4)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     709716 (PDIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 523 aa AA seqDB search
MRPRKAYLFLLLLGLAQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDEEEDDLEVKEE
NGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDNDPPIPVAKID
ATSASMLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLV
LTKENFDEVVNDADIILVEFYAPWSNNLREDYKFHHAFSTEIAKFLKVSQGQLVVMQPEK
FQSKYEPRSHVMDVQGSTQDSAIKDFVLKYALPLVGHRKASNEAKRYTRRPLVVVYYSVD
FSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDES
GKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDP
KKDVLIEFYAPWCGHCKQLEPVYSSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGFPT
IYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggaaagcctacctgttcctgctgctccttgggctggcgcagctgctggcc
gtggcgggtgccgagggcccggacgaagattcttctaaccgagaaaatgccattgaggat
gaagaggaggaggaggaggaagatgatgaggaagaagatgacttggaagttaaggaagaa
aatggtgtcttggtcctaaatgatgcaaactttgataattttgtggctgacaaagacaca
gtgctgctggaattttatgctccatggtgtggacattgcaagcagtttgctccggaatat
gaaaaaattgccaacatattaaaggataatgatcctcccattcctgttgccaagatcgat
gcaacctcagcatctatgctggccagcaggtttgatgtgagtggctaccccaccatcaag
atccttaagaaggggcaggctgtagactacgagggctccagaacccaagaagaaattgtt
gccaaggtcagagaagtctcccagcccgactggacgcctccaccagaagtcacgcttgtg
ttgaccaaagagaactttgatgaagttgtgaatgatgcagatatcattctggtggagttt
tatgctccatggtctaacaacctgagagaagattacaaatttcaccatgctttcagcaca
gaaattgcaaagttcttgaaagtctcccaggggcagttggttgtaatgcagcctgagaaa
ttccagtccaagtatgagccccggagccacgtgatggacgtccagggctccacccaggac
tcagccatcaaggacttcgtgctgaagtacgccctgcccctggttggccaccgcaaggca
tcaaacgaggctaagcgctacaccaggcgccccctggtggttgtctactacagtgtggac
ttcagctttgattacagagctgcaactcagttttggcggagcaaagtcctagaggtggcc
aaggacttccctgagtacacctttgccattgcggacgaggaggactatgctggggaggtg
aaggacctggggctcagcgagagcggggaggatgtcaacgccgccatcctggacgagagc
gggaagaagttcgccatggagccggaggagtttgactccgacaccctccgcgagtttgtc
actgctttcaaaaaaggaaaactgaagccagtcatcaaatcccagccagtgcccaagaac
aacaagggacccgtcaaggttgttgtgggaaagactttcgactccattgtgatggacccc
aagaaggacgtcctcatcgagttctacgcgccatggtgcgggcattgcaagcagctggag
cccgtgtacagcagcctggccaagaagtacaaaggccagaagggcctggtcattgccaag
atggacgccacagccaacgacgtccccagcgaccgctataaggtggagggcttccccacc
atctactttgcccccagtggggacaaaaagaacccagttaaatttgagggtggagacaga
gatctggagcatttgagcaagtttatagaagaacatgccacaaaactgagcaggaccaag
gaagagctttga

DBGET integrated database retrieval system