KEGG   Macaca mulatta (rhesus monkey): 709728Help
Entry
709728            CDS       T01028                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04114  Oocyte meiosis
mcc04140  Autophagy - animal
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04310  Wnt signaling pathway
mcc04340  Hedgehog signaling pathway
mcc04371  Apelin signaling pathway
mcc04530  Tight junction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04720  Long-term potentiation
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04726  Serotonergic synapse
mcc04727  GABAergic synapse
mcc04728  Dopaminergic synapse
mcc04740  Olfactory transduction
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04910  Insulin signaling pathway
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04919  Thyroid hormone signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing's syndrome
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04976  Bile secretion
mcc05012  Parkinson's disease
mcc05020  Prion diseases
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05146  Amoebiasis
mcc05165  Human papillomavirus infection
mcc05166  HTLV-I infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
mcc05205  Proteoglycans in cancer
mcc05414  Dilated cardiomyopathy (DCM)
Module
mcc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    709728 (PRKACB)
   04010 MAPK signaling pathway
    709728 (PRKACB)
   04310 Wnt signaling pathway
    709728 (PRKACB)
   04340 Hedgehog signaling pathway
    709728 (PRKACB)
   04371 Apelin signaling pathway
    709728 (PRKACB)
   04020 Calcium signaling pathway
    709728 (PRKACB)
   04024 cAMP signaling pathway
    709728 (PRKACB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    709728 (PRKACB)
  Cell growth and death
   04114 Oocyte meiosis
    709728 (PRKACB)
  Cellular community - eukaryotes
   04530 Tight junction
    709728 (PRKACB)
   04540 Gap junction
    709728 (PRKACB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    709728 (PRKACB)
   04062 Chemokine signaling pathway
    709728 (PRKACB)
  Endocrine system
   04911 Insulin secretion
    709728 (PRKACB)
   04910 Insulin signaling pathway
    709728 (PRKACB)
   04922 Glucagon signaling pathway
    709728 (PRKACB)
   04923 Regulation of lipolysis in adipocyte
    709728 (PRKACB)
   04912 GnRH signaling pathway
    709728 (PRKACB)
   04913 Ovarian Steroidogenesis
    709728 (PRKACB)
   04915 Estrogen signaling pathway
    709728 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    709728 (PRKACB)
   04921 Oxytocin signaling pathway
    709728 (PRKACB)
   04926 Relaxin signaling pathway
    709728 (PRKACB)
   04918 Thyroid hormone synthesis
    709728 (PRKACB)
   04919 Thyroid hormone signaling pathway
    709728 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    709728 (PRKACB)
   04916 Melanogenesis
    709728 (PRKACB)
   04924 Renin secretion
    709728 (PRKACB)
   04925 Aldosterone synthesis and secretion
    709728 (PRKACB)
   04927 Cortisol synthesis and secretion
    709728 (PRKACB)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    709728 (PRKACB)
   04270 Vascular smooth muscle contraction
    709728 (PRKACB)
  Digestive system
   04970 Salivary secretion
    709728 (PRKACB)
   04971 Gastric acid secretion
    709728 (PRKACB)
   04976 Bile secretion
    709728 (PRKACB)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    709728 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    709728 (PRKACB)
  Nervous system
   04724 Glutamatergic synapse
    709728 (PRKACB)
   04727 GABAergic synapse
    709728 (PRKACB)
   04725 Cholinergic synapse
    709728 (PRKACB)
   04728 Dopaminergic synapse
    709728 (PRKACB)
   04726 Serotonergic synapse
    709728 (PRKACB)
   04720 Long-term potentiation
    709728 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    709728 (PRKACB)
  Sensory system
   04740 Olfactory transduction
    709728 (PRKACB)
   04742 Taste transduction
    709728 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    709728 (PRKACB)
  Aging
   04211 Longevity regulating pathway - mammal
    709728 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    709728 (PRKACB)
  Environmental adaptation
   04713 Circadian entrainment
    709728 (PRKACB)
   04714 Thermogenesis
    709728 (PRKACB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    709728 (PRKACB)
   05205 Proteoglycans in cancer
    709728 (PRKACB)
   05203 Viral carcinogenesis
    709728 (PRKACB)
  Neurodegenerative diseases
   05012 Parkinson's disease
    709728 (PRKACB)
   05020 Prion diseases
    709728 (PRKACB)
  Substance dependence
   05030 Cocaine addiction
    709728 (PRKACB)
   05031 Amphetamine addiction
    709728 (PRKACB)
   05032 Morphine addiction
    709728 (PRKACB)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    709728 (PRKACB)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    709728 (PRKACB)
  Infectious diseases
   05166 HTLV-I infection
    709728 (PRKACB)
   05169 Epstein-Barr virus infection
    709728 (PRKACB)
   05165 Human papillomavirus infection
    709728 (PRKACB)
   05146 Amoebiasis
    709728 (PRKACB)
  Drug resistance
   01522 Endocrine resistance
    709728 (PRKACB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     709728 (PRKACB)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: AGC group
  PKA family
   709728 (PRKACB)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     709728 (PRKACB)
Chromosome and associated proteins [BR:mcc03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    709728 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 709728
NCBI-ProteinID: NP_001247888
Ensembl: ENSMMUG00000003457
UniProt: H9FWY1
Position
1
AA seq 351 aa AA seqDB search
MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVML
VKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVSDIKTHKWFAT
TDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcggcgaccgccaagaaaggcagcgaggtggagagcgtgaaagagtttcta
gccaaagccaaagaagactttttgaaaaaatgggagaatccaactcagaataatgccgga
cttgaagattttgaaaggaaaaaaacccttggaacaggttcatttggaagagtcatgttg
gtaaaacacaaagctactgaacagtattatgccatgaagatcttagataagcagaaggtt
gttaaactgaagcaaatagagcatactttgaatgagaaaagaatattacaggcagtgaat
tttcctttccttgttcgactggagtatgcttttaaggataattctaatttatacatggtt
atggaatatgtccctgggggtgaaatgttttcacatctaagaagaattggaaggttcagt
gaaccccatgcccggttctatgcagctcagatagtgctaacattcgagtacctccattca
ctagacctcatctacagagatctaaaacctgaaaatctcttaattgaccatcaaggctat
atccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttggacattatgt
ggaactccagagtatttggctccagaaataattctcagcaagggctacaataaggcagtg
gattggtgggcattaggagtgctaatctatgaaatggcagctggctatcccccattcttt
gcagaccaaccaattcagatttatgaaaagattgtttctggaaaggtccgattcccatcc
cacttcagttcagatctcaaggaccttctacggaacctgctgcaggtggatttgaccaag
agatatggaaatctaaagaatggtgtcagtgatataaaaactcacaagtggtttgccacg
acagattggattgctatttaccagaggaaggttgaagctccattcataccaaagtttaga
ggctctggagataccagcaactttgatgactatgaagaagaagatatccgtgtctctata
acagaaaaatgtgcaaaagaatttggtgaattttaa

DBGET integrated database retrieval system