KEGG   Macaca mulatta (rhesus monkey): 709770Help
Entry
709770            CDS       T01028                                 

Gene name
CYP3A43
Definition
cytochrome P450, family 3, subfamily A, polypeptide 43 (EC:1.14.14.1)
Orthology
K17692  
cytochrome P450, family 3, subfamily A, polypeptide 43 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    709770 (CYP3A43)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     709770 (CYP3A43)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP3 family
   709770 (CYP3A43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 454 aa AA seqDB search
MDLIPNFAMETWVLVATSLVLLYMLYEGQQPMPVIMDPDMIKTVLVKECYSVFTNRMPLG
PMGFMKSALSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRREAENSKP
TNLKDFFGAYTMDVITGTLFGVNLDSLNNPQDPFLKNMKKLLKLDFLDPFLLSISLFPFL
TPVFEVLNIGLFPKDVTRFLKNSIERMKESRLKDKQKHRVDFFQQMIDSQNSKETKSHKA
LSDLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDA
LVQMEYLDIVANETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWT
EPEKFCPERFSKKNKDSIDPYRYIPFGAGPRNCIGMRFALTNIKLAVIKALQNFSFEPCE
ETQLPLKLNNLPILQPENPIVLKVHLRDGITSGP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggatctcattccaaactttgccatggaaacatgggttctcgtggctaccagcttggta
ctcctctatatgctgtatgagggacaacagcccatgccggtcatcatggatcccgacatg
atcaaaacagtactagtgaaagaatgttactctgtcttcacaaaccggatgcctttaggt
ccaatgggatttatgaaaagtgccttaagttttgctgaagatgaagaatggaagagaata
cgaacattgctatctccagctttcaccagtgtaaaattcaaggaaatggtccccatcatt
tcccagtgtggagatatgttggtgagaagcctgaggcgggaagcagagaacagcaaaccc
accaacttgaaagatttctttggggcctacaccatggatgtaatcactggcacattgttt
ggagtgaacttggattccctcaacaacccacaagatccctttctgaaaaatatgaagaag
cttttaaaattggattttttggatccctttttactctcaatatcactctttccatttctt
accccagtttttgaagtcctaaatatcggtttgtttccaaaagatgttacccgtttttta
aaaaattccattgaaaggatgaaagaaagtcgcctcaaagataaacaaaagcaccgagta
gatttctttcaacagatgattgactcccagaattccaaagaaacaaagtcccataaagct
ctgtctgacctggagcttgtggcccagtcaattatcattatttttgctgcctatgacaca
actagcaccactctccccttcattatgtatgaactggccactcaccctgatgtccagcag
aaactgcaggaggagattgacgcagttttgcccaataaggcacctgtcacttacgatgcc
ctggtacagatggagtaccttgacatagtggcgaatgaaacgctcagattattcccagtt
gttagtagagttacaagagtctgcaaaaaagatattgaaatcaatggggtgttcattccc
aaagggttagcagtgatggttccaatctacgctcttcaccatgacccaaagtactggaca
gagcctgagaagttctgccctgaaaggttcagtaagaagaacaaggacagcatagatcct
tacagatacataccttttggagctggaccccgaaactgcattggcatgaggtttgctctc
acaaacataaaactagctgtcattaaagcactgcagaacttctccttcgaaccttgtgaa
gaaactcagctcccactgaaattaaacaatctaccaattcttcaaccagaaaaccctatt
gttttaaaagtgcacttaagagatgggattacaagtggaccctga

DBGET integrated database retrieval system