KEGG   Macaca mulatta (rhesus monkey): 709856Help
Entry
709856            CDS       T01028                                 

Definition
calcium-activated potassium channel subunit beta-3-like
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:mcc04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mcc04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 173 aa AA seqDB search
MQPFSIPVQITLQGSRRRQGRTAFPASGKKRETDYSDGDPLDVHKRLSSSAGEDRAVLLG
FAMMGFSVLMFFLLGTTILKPFMLSAQREESTCTAIHTDIMDHWLDCTFTCGVHCRGQGK
YPCLQVLVNLTHSGQKALLHYNEEAVQINPKRDVTDCRVKEKQTLTVSDEHKQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcagcatccccgtgcaaatcacactccagggcagccggaggcgccagggg
aggacagcctttcctgcctcagggaagaagagagagacagactacagtgatggagaccca
ctggatgtgcacaagaggctgtcgtccagtgctggagaggaccgagccgtgctgctgggg
tttgccatgatgggcttctcagtcctaatgttcttcttgcttggaacaaccattctaaag
ccttttatgctcagtgctcagagagaagaatcgacctgcactgccatccacacagatatc
atggaccactggctggactgtaccttcacctgtggtgtgcactgccgcggtcaggggaag
tacccgtgtcttcaggtgttggtgaacctcacccattcaggtcagaaagctctcctacat
tataatgaagaggctgtccagataaatcccaagcgtgatgttacagactgcagagttaaa
gaaaagcagacattgacagtttctgatgagcacaaacagtaa

DBGET integrated database retrieval system