KEGG   Macaca mulatta (rhesus monkey): 709856Help
Entry
709856            CDS       T01028                                 

Definition
calcium-activated potassium channel subunit beta-3-like
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    709856
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    709856
  Circulatory system
   04270 Vascular smooth muscle contraction
    709856
Ion channels [BR:mcc04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   709856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 173 aa AA seqDB search
MQPFSIPVQITLQGSRRRQGRTAFPASGKKRETDYSDGDPLDVHKRLSSSAGEDRAVLLG
FAMMGFSVLMFFLLGTTILKPFMLSAQREESTCTAIHTDIMDHWLDCTFTCGVHCRGQGK
YPCLQVLVNLTHSGQKALLHYNEEAVQINPKRDVTDCRVKEKQTLTVSDEHKQ
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccttcagcatccccgtgcaaatcacactccagggcagccggaggcgccagggg
aggacagcctttcctgcctcagggaagaagagagagacagactacagtgatggagaccca
ctggatgtgcacaagaggctgtcgtccagtgctggagaggaccgagccgtgctgctgggg
tttgccatgatgggcttctcagtcctaatgttcttcttgcttggaacaaccattctaaag
ccttttatgctcagtgctcagagagaagaatcgacctgcactgccatccacacagatatc
atggaccactggctggactgtaccttcacctgtggtgtgcactgccgcggtcaggggaag
tacccgtgtcttcaggtgttggtgaacctcacccattcaggtcagaaagctctcctacat
tataatgaagaggctgtccagataaatcccaagcgtgatgttacagactgcagagttaaa
gaaaagcagacattgacagtttctgatgagcacaaacagtaa

DBGET integrated database retrieval system