KEGG   Macaca mulatta (rhesus monkey): 709935Help
Entry
709935            CDS       T01028                                 

Gene name
PPP1CC
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc03015  mRNA surveillance pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04390  Hippo signaling pathway
mcc04510  Focal adhesion
mcc04611  Platelet activation
mcc04720  Long-term potentiation
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04810  Regulation of actin cytoskeleton
mcc04910  Insulin signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04931  Insulin resistance
mcc05031  Amphetamine addiction
mcc05034  Alcoholism
mcc05168  Herpes simplex infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    709935 (PPP1CC)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    709935 (PPP1CC)
   04024 cAMP signaling pathway
    709935 (PPP1CC)
   04022 cGMP - PKG signaling pathway
    709935 (PPP1CC)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    709935 (PPP1CC)
   04218 Cellular senescence
    709935 (PPP1CC)
  Cellular community - eukaryotes
   04510 Focal adhesion
    709935 (PPP1CC)
  Cell motility
   04810 Regulation of actin cytoskeleton
    709935 (PPP1CC)
 Organismal Systems
  Immune system
   04611 Platelet activation
    709935 (PPP1CC)
  Endocrine system
   04910 Insulin signaling pathway
    709935 (PPP1CC)
   04921 Oxytocin signaling pathway
    709935 (PPP1CC)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    709935 (PPP1CC)
   04270 Vascular smooth muscle contraction
    709935 (PPP1CC)
  Nervous system
   04728 Dopaminergic synapse
    709935 (PPP1CC)
   04720 Long-term potentiation
    709935 (PPP1CC)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    709935 (PPP1CC)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    709935 (PPP1CC)
  Substance dependence
   05031 Amphetamine addiction
    709935 (PPP1CC)
   05034 Alcoholism
    709935 (PPP1CC)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    709935 (PPP1CC)
  Infectious diseases
   05168 Herpes simplex infection
    709935 (PPP1CC)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     709935 (PPP1CC)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     709935 (PPP1CC)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     709935 (PPP1CC)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     709935 (PPP1CC)
Spliceosome [BR:mcc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    709935 (PPP1CC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 709935
NCBI-ProteinID: NP_001244760
Ensembl: ENSMMUG00000013664
UniProt: H9YUD3
Position
11
AA seq 323 aa AA seqDB search
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttagacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaacgtccagcttcaggagaatgaaatcagaggactgtgttta
aaatctcgtgaaatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttgctgcgactttttgagtacggtggt
ttcccgccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagacgatctgcctcttactggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggatgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacgcctccaaggggtatgatcacaaagcaa
gcaaagaaatag

DBGET integrated database retrieval system