KEGG   Macaca mulatta (rhesus monkey): 709935Help
Entry
709935            CDS       T01028                                 

Gene name
PPP1CC
Definition
protein phosphatase 1, catalytic subunit, gamma isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mRNA surveillance pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:mcc03015]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:mcc04390]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mcc04810]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:mcc04114]
Cellular Processes; Cell communication; Focal adhesion [PATH:mcc04510]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mcc04910]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:mcc04921]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:mcc04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mcc04270]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:mcc04728]
Organismal Systems; Nervous system; Long-term potentiation [PATH:mcc04720]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mcc04750]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:mcc05205]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:mcc05031]
Human Diseases; Substance dependence; Alcoholism [PATH:mcc05034]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mcc05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 323 aa AA seqDB search
MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatttagacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagcctggtaagaacgtccagcttcaggagaatgaaatcagaggactgtgttta
aaatctcgtgaaatctttctcagtcagcctatcctactagaacttgaagcaccactcaaa
atatgtggtgacatccatgggcaatactatgatttgctgcgactttttgagtacggtggt
ttcccgccagaaagcaactacctgtttcttggggactatgtggacaggggaaagcagtca
ttggagacgatctgcctcttactggcctacaaaatcaaatatcctgagaatttttttctt
ctcagagggaaccatgaatgtgccagcatcaacagaatttatggattttatgatgaatgt
aaaagaagatacaacattaaactatggaaaactttcacagactgttttaactgtttaccg
atagcagccatcgtggatgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgcgaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggatatgaattttttgcaaag
aggcagttggtcactctgttttctgcgcccaattattgtggagagtttgacaatgcaggt
gccatgatgagtgtggatgaaacactaatgtgttcttttcagattttaaagcctgcagag
aaaaagaagccaaatgccacgagacctgtaacgcctccaaggggtatgatcacaaagcaa
gcaaagaaatag

DBGET integrated database retrieval system