KEGG   Macaca mulatta (rhesus monkey): 710077Help
Entry
710077            CDS       T01028                                 

Definition
dual specificity mitogen-activated protein kinase kinase 7-like
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    710077
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    710077
   04012 ErbB signaling pathway
    710077
   04668 TNF signaling pathway
    710077
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    710077
   04660 T cell receptor signaling pathway
    710077
   04664 Fc epsilon RI signaling pathway
    710077
  Endocrine system
   04912 GnRH signaling pathway
    710077
  Nervous system
   04722 Neurotrophin signaling pathway
    710077
  Development
   04380 Osteoclast differentiation
    710077
 Human Diseases
  Infectious diseases
   05164 Influenza A
    710077
   05169 Epstein-Barr virus infection
    710077
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     710077
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   710077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
19
AA seq 360 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKXXXXXXXXXILGKMTVAIVKALYYLKEKHGV
IHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDY
DIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKD
CLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctcggagagc
tccccgcagcaccccacgccccccgcccggccccgccacatgctggggctcccgtcaacc
ctgttcacgcctcgaagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaatgacctg
gagaacttgggtgagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccgg
aagaccggccacgtcattgccgttaagnnnnnnnnnnnnnnnnnnnnnnnnngcatcctg
ggcaagatgacagtggcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtc
atccaccgcgacgtcaagccctccaacatcctgctggacgagcggggccagatcaagctt
tgcgacttcggcatcagcggccgcctggtggactccaaagccaaaacgcggagcgccggc
tgcgcagcctacatggcgcccgagcgcattgaccccccagaccccaccaagccagactat
gacatccgggccgatgtatggagcctgggcatctcgttggtggagctggcaacaggacag
tttccctacaagaactgcaagacggactttgaggtcctcaccaaagtcctacaggaagag
cccccgcttctgcccggacacatgggcttctcgggggacttccagtccttcgtcaaagac
tgccttactaaagatcacaggaagagaccaaagtataataagctacttgaacacagcttc
atcaagcgctacgagacgctggaggtggacgtggcgtcctggttcaaggatgtcatggcg
aagactgagtcaccgcggactagcggcgtcctgagccagccccacctgcccttcttcagg
tag

DBGET integrated database retrieval system