KEGG   Macaca mulatta (rhesus monkey): 710155Help
Entry
710155            CDS       T01028                                 

Gene name
SCD
Definition
stearoyl-CoA desaturase (delta-9-desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    710155 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    710155 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    710155 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    710155 (SCD)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     710155 (SCD)
Lipid biosynthesis proteins [BR:mcc01004]
 Desaturase
  First
   710155 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 362 aa AA seqDB search
MPAHLLQEDISSSYTTTTTITAPPSRVLQNGRDKLETTPLYLEEDVRPDIKDDIYDPTYK
DKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKLYTCLWGLFYYVVSALGITAGAH
RLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGATLDLSDLEAEKLVMFQRRYYKPGLLLMCFILPTLVPWCFWGE
TFQHSVFVATFLRYAIVLNVTWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINFTTFFIDCMAHCPPFHFVAIALLSLIASQASSWSVFVQCPAS
KA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccatttgctgcaggaggatatctctagctcctataccaccaccaccaccatc
acagcgcctccctccagggtcctgcagaatggaagagataagttggagacgacgcccctc
tacttggaagaagacgttcgccctgatatcaaagatgatatatatgaccccacctacaag
gataaggaaggcccaagccccaaggttgaatatgtctggagaaacatcatccttatgtct
ctgctacacttgggagccctgtatgggatcactttgattcctacttgcaagctctacacc
tgtctttgggggttattctactatgttgtcagtgccctgggcataacagcaggagctcat
cgtctatggagccaccgatcttacaaagctcggctgcccctgcgtctctttctgatcatt
gccaacacaatggcgttccagaatgatgtctatgaatgggctcgtgaccaccgtgcccac
cacaagttttcggaaactcatgctgatcctcataattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcaaagagaagggcgctacgcta
gacttgtctgacctagaagccgagaaactggtgatgttccagaggaggtactacaaacct
ggcttgctgctgatgtgcttcatcctgcccacgcttgtgccctggtgtttctggggtgaa
acttttcaacacagcgtgtttgttgccactttcttgcgatatgctatagtgcttaatgtc
acctggctggtgaacagtgctgcccacctcttcggatatcgtccttatgacaagaacatc
agtccccgggagaatatcctggtgtcacttggagctgtgggtgagggcttccacaactac
caccactcctttccctatgactactctgccagtgagtaccgctggcacatcaacttcacc
acattcttcattgattgcatggcccattgtcctccttttcactttgttgctatcgccctc
ctttctcttattgcctcccaggcaagcagctggtcagtctttgttcagtgtccagcttcc
aaagcctag

DBGET integrated database retrieval system