KEGG   Macaca mulatta (rhesus monkey): 710200Help
Entry
710200            CDS       T01028                                 

Gene name
E2F2
Definition
(RefSeq) E2F transcription factor 2
  KO
K09389  transcription factor E2F2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04110  Cell cycle
mcc04218  Cellular senescence
mcc04934  Cushing's syndrome
mcc05161  Hepatitis B
mcc05166  HTLV-I infection
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05212  Pancreatic cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05220  Chronic myeloid leukemia
mcc05222  Small cell lung cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
Module
mcc_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    710200 (E2F2)
   04218 Cellular senescence
    710200 (E2F2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    710200 (E2F2)
   05206 MicroRNAs in cancer
    710200 (E2F2)
   05212 Pancreatic cancer
    710200 (E2F2)
   05225 Hepatocellular carcinoma
    710200 (E2F2)
   05226 Gastric cancer
    710200 (E2F2)
   05214 Glioma
    710200 (E2F2)
   05220 Chronic myeloid leukemia
    710200 (E2F2)
   05218 Melanoma
    710200 (E2F2)
   05219 Bladder cancer
    710200 (E2F2)
   05215 Prostate cancer
    710200 (E2F2)
   05224 Breast cancer
    710200 (E2F2)
   05222 Small cell lung cancer
    710200 (E2F2)
   05223 Non-small cell lung cancer
    710200 (E2F2)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    710200 (E2F2)
  Infectious diseases
   05166 HTLV-I infection
    710200 (E2F2)
   05161 Hepatitis B
    710200 (E2F2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    710200 (E2F2)
  Drug resistance
   01522 Endocrine resistance
    710200 (E2F2)
Transcription factors [BR:mcc03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    710200 (E2F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E2F_CC-MB E2F_TDP
Motif
Other DBs
NCBI-GeneID: 710200
NCBI-ProteinID: XP_001102839
Ensembl: ENSMMUG00000011832
UniProt: F7H757
Position
1
AA seq 437 aa AA seqDB search
MLQGPRALVSAAGQPPKVVPAMSPTELWPSGLSSPQLCPATTTYYTPLYPQTAPPAVAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPAVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNIEEALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggtttcggccgctgggcagcccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actaccacctactacacgccgctgtacccgcagacggcgcctcccgcagtggcgcccggc
acctgcctcgatgccactccccacggacccgagggccaagttgttcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcctgccgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacctcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacatc
gaggaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcggcaac
tttaaggagcaaacagtgattgccgtcaaggcccctccgcagacaagactggaagtgccc
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccattgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcccctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcgtgcagctcccctctg
atcagcttctccccgtccttggaccaggacgactacctgtggggcttggaggcgggtgag
ggcatcagcgacctcttcgactcctacgacctcggggacctgttgattaattga

DBGET integrated database retrieval system