KEGG   Macaca mulatta (rhesus monkey): 710200Help
Entry
710200            CDS       T01028                                 

Gene name
E2F2
Definition
E2F transcription factor 2
Orthology
K09389  
transcription factor E2F2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Cell cycle
Hepatitis B
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Pancreatic cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:mcc04110]
Human Diseases; Cancers; Pathways in cancer [PATH:mcc05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mcc05206]
Human Diseases; Cancers; Pancreatic cancer [PATH:mcc05212]
Human Diseases; Cancers; Glioma [PATH:mcc05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mcc05220]
Human Diseases; Cancers; Melanoma [PATH:mcc05218]
Human Diseases; Cancers; Bladder cancer [PATH:mcc05219]
Human Diseases; Cancers; Prostate cancer [PATH:mcc05215]
Human Diseases; Cancers; Small cell lung cancer [PATH:mcc05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:mcc05223]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mcc05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mcc05161]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 437 aa AA seqDB search
MLQGPRALVSAAGQPPKVVPAMSPTELWPSGLSSPQLCPATTTYYTPLYPQTAPPAVAPG
TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPAVPEFPTPKGKCIRVDGLPSPKT
PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNIEEALDQLIQSCSLSFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
PPPSLVPLEATDSMLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
GISDLFDSYDLGDLLIN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagggccccgggccttggtttcggccgctgggcagcccccgaaggtggtgccc
gcgatgagccccacagagctgtggccatccggcctcagcagcccccagctctgcccagct
actaccacctactacacgccgctgtacccgcagacggcgcctcccgcagtggcgcccggc
acctgcctcgatgccactccccacggacccgagggccaagttgttcgatgcctgccggca
ggccggctgccggccaaaaggaagctggatctggaggggattgggaggcctgccgtccct
gagttcccaacccccaaggggaagtgcatcagagtggatggcctccccagccccaaaacc
cccaaatcccccggggagaagactcggtatgacacctcgctggggctgctcaccaagaag
ttcatttacctcctgagcgagtcagaggatggggtcctggacctgaactgggccgctgag
gtgctggacgtgcagaagcggcgcatctatgacatcaccaacgtgctggagggcatccag
ctcatccgcaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcaacagctggggcaggagctgaaggagctgatgaacatc
gaggaggccttggaccagctcatccagagctgctctctgagcttcaagcacctgactgag
gacaaggccaacaagaggctggcctatgtgacttaccaggatatccgtgctgtcggcaac
tttaaggagcaaacagtgattgccgtcaaggcccctccgcagacaagactggaagtgccc
gacaggactgaggacaacctgcagatatatctcaagagcacccaagggcccattgaagtc
tacctgtgcccagaggaggtgcaggagccggacagtccttccgaggagcccctcccctct
acctccaccctctgccccagccctgactctgcccagcccagcagcagcaccgaccctagc
atcatggagcccacagcatcctcagtgccagcgccagcgccaaccccccagcaggcccca
ccgcctccatccctggtccccttggaggctactgacagcatgctggagctgccgcaccca
ctcctgcagcagactgaggaccagttcctgtccccgaccctggcgtgcagctcccctctg
atcagcttctccccgtccttggaccaggacgactacctgtggggcttggaggcgggtgag
ggcatcagcgacctcttcgactcctacgacctcggggacctgttgattaattga

DBGET integrated database retrieval system