KEGG   Macaca mulatta (rhesus monkey): 710241Help
Entry
710241            CDS       T01028                                 

Gene name
PRF1
Definition
perforin 1 (pore forming protein)
Orthology
K07818  
perforin 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    710241 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    710241 (PRF1)
   05330 Allograft rejection
    710241 (PRF1)
   05332 Graft-versus-host disease
    710241 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    710241 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    710241 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 555 aa AA seqDB search
MAACLLLLGILLLLLPLPVPAPCHTATRSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPHPAGNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYS
YHVVHTPPLHPDFKRALGDLPLHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDDEVDDCLNVEAQVNIGARGSSSAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGSQAGPEQYSAWVNSLLGSPGLVDYSLEPLHVLLDSQDPRREAL
RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKVFFGGQELRTNTQWSNNNPIWSMPLDFGDVLLATGGPLRL
QVWDQDSGWDDDLLGTCDQAPKSGSHEARCNLKHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctgcctgctcctcctgggcatccttctcctgctgctgcccctgccggtccct
gctccctgccacacagccacacgctcagagtgcaagcgcagccacaagtttgtgcccggt
gcatggctggccggggagggtgtggacgtgaccagcctccgccgctcgggctccttccca
gtagacacacaaaggttcctgcggcccgacggcacctgcaccctctgtgaaaatgcccta
caggagggcaccctccagcgcctgcccctggcactcaccaactggcgggcccagggctct
ggctgccagcgccatgtaaccagggccaaagtcagctccactgaagctgtggcccgggat
gcggctcgtagcatccgcaacgactggaaggtcgggctggatgtgactccccaccccgcc
ggcaacgtgcatgtgtctgtggccggctcacactcacaggcagccaactttgcagcccag
aagacccaccaggaccagtacagcttcagcactgacacagtggagtgccgcttctacagt
taccatgtggtacacactcccccgctgcaccctgacttcaagagggccctcggggacctg
cccctccacttcaatgcctccacccagcccgcctacctcaggctcatctccaactacggc
acccacttcatccgggctgtggagctgggcggccgcatctcggccctcactgccctgcgc
acgtgtgaactggccctggaagggctcacggacgacgaggtggatgactgcctgaacgtc
gaggcccaggtcaacataggcgcccgcggcagctcctctgccgaagccaaagcctgtgag
gagaagaagaagaagcacaagatgacggcctccttccaccaaacctaccgggagcgccat
tcggaagtggttggcggccatcacacctccattaacgacctgctgttcgggagccaggcc
gggcccgagcagtactcagcctgggtgaactcgctgctcggcagccctggcctggtggac
tacagcctggaacccctgcatgtgctgctggacagccaggacccgcggcgggaggcactg
aggagggccctgagtcagtacctgacggacagggctcgctggagggactgcagccggccg
tgcccaccggggcggcagaagagcccccgagacccgtgccagtgtgtgtgccatggctca
gcggtcaccacccaggactgctgccctcgacagaggggcctggcccagctggaggtgacc
ttcatccaagcgtggggcctgtggggggactggttcactgccacggatgcctatgtgaag
gtgttctttggtggccaggagctcaggacgaacacccagtggagcaataacaaccccatc
tggtcaatgccgctggattttggggatgtgctcctggccacaggggggcccctgaggttg
caggtctgggatcaggactctggctgggacgatgacctccttggcacctgtgatcaggct
cccaagtctggttcccatgaggcgagatgcaacctgaaacatggccacctgaaattccgc
tatcacgccaggtgcttgccccacctgggaggaggcacctgcctggactacgtcccccaa
atgcttctgggggagcctccaggaaaccggagtggggccgtgtggtga

DBGET integrated database retrieval system