KEGG   Macaca mulatta (rhesus monkey): 710241Help
Entry
710241            CDS       T01028                                 

Gene name
PRF1
Definition
(RefSeq) perforin 1
  KO
K07818  
perforin 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    710241 (PRF1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    710241 (PRF1)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    710241 (PRF1)
   05330 Allograft rejection
    710241 (PRF1)
   05332 Graft-versus-host disease
    710241 (PRF1)
  Cardiovascular diseases
   05416 Viral myocarditis
    710241 (PRF1)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    710241 (PRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
9
AA seq 555 aa AA seqDB search
MAACLLLLGILLLLLPLPVPAPCHTATRSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPHPAGNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYS
YHVVHTPPLHPDFKRALGDLPLHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDDEVDDCLNVEAQVNIGARGSSSAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGSQAGPEQYSAWVNSLLGSPGLVDYSLEPLHVLLDSQDPRREAL
RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKVFFGGQELRTNTQWSNNNPIWSMPLDFGDVLLATGGPLRL
QVWDQDSGWDDDLLGTCDQAPKSGSHEARCNLKHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctgcctgctcctcctgggcatccttctcctgctgctgcccctgccggtccct
gctccctgccacacagccacacgctcagagtgcaagcgcagccacaagtttgtgcccggt
gcatggctggccggggagggtgtggacgtgaccagcctccgccgctcgggctccttccca
gtagacacacaaaggttcctgcggcccgacggcacctgcaccctctgtgaaaatgcccta
caggagggcaccctccagcgcctgcccctggcactcaccaactggcgggcccagggctct
ggctgccagcgccatgtaaccagggccaaagtcagctccactgaagctgtggcccgggat
gcggctcgtagcatccgcaacgactggaaggtcgggctggatgtgactccccaccccgcc
ggcaacgtgcatgtgtctgtggccggctcacactcacaggcagccaactttgcagcccag
aagacccaccaggaccagtacagcttcagcactgacacagtggagtgccgcttctacagt
taccatgtggtacacactcccccgctgcaccctgacttcaagagggccctcggggacctg
cccctccacttcaatgcctccacccagcccgcctacctcaggctcatctccaactacggc
acccacttcatccgggctgtggagctgggcggccgcatctcggccctcactgccctgcgc
acgtgtgaactggccctggaagggctcacggacgacgaggtggatgactgcctgaacgtc
gaggcccaggtcaacataggcgcccgcggcagctcctctgccgaagccaaagcctgtgag
gagaagaagaagaagcacaagatgacggcctccttccaccaaacctaccgggagcgccat
tcggaagtggttggcggccatcacacctccattaacgacctgctgttcgggagccaggcc
gggcccgagcagtactcagcctgggtgaactcgctgctcggcagccctggcctggtggac
tacagcctggaacccctgcatgtgctgctggacagccaggacccgcggcgggaggcactg
aggagggccctgagtcagtacctgacggacagggctcgctggagggactgcagccggccg
tgcccaccggggcggcagaagagcccccgagacccgtgccagtgtgtgtgccatggctca
gcggtcaccacccaggactgctgccctcgacagaggggcctggcccagctggaggtgacc
ttcatccaagcgtggggcctgtggggggactggttcactgccacggatgcctatgtgaag
gtgttctttggtggccaggagctcaggacgaacacccagtggagcaataacaaccccatc
tggtcaatgccgctggattttggggatgtgctcctggccacaggggggcccctgaggttg
caggtctgggatcaggactctggctgggacgatgacctccttggcacctgtgatcaggct
cccaagtctggttcccatgaggcgagatgcaacctgaaacatggccacctgaaattccgc
tatcacgccaggtgcttgccccacctgggaggaggcacctgcctggactacgtcccccaa
atgcttctgggggagcctccaggaaaccggagtggggccgtgtggtga

DBGET integrated database retrieval system