KEGG   Macaca mulatta (rhesus monkey): 710241Help
Entry
710241            CDS       T01028                                 

Gene name
PRF1
Definition
perforin 1 (pore forming protein)
Orthology
K07818  
perforin 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Natural killer cell mediated cytotoxicity
Type I diabetes mellitus
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Viral myocarditis
Class
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:mcc04650]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:mcc05320]
Human Diseases; Immune diseases; Allograft rejection [PATH:mcc05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:mcc05332]
Human Diseases; Cardiovascular diseases; Viral myocarditis [PATH:mcc05416]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:mcc04940]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 555 aa AA seqDB search
MAACLLLLGILLLLLPLPVPAPCHTATRSECKRSHKFVPGAWLAGEGVDVTSLRRSGSFP
VDTQRFLRPDGTCTLCENALQEGTLQRLPLALTNWRAQGSGCQRHVTRAKVSSTEAVARD
AARSIRNDWKVGLDVTPHPAGNVHVSVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYS
YHVVHTPPLHPDFKRALGDLPLHFNASTQPAYLRLISNYGTHFIRAVELGGRISALTALR
TCELALEGLTDDEVDDCLNVEAQVNIGARGSSSAEAKACEEKKKKHKMTASFHQTYRERH
SEVVGGHHTSINDLLFGSQAGPEQYSAWVNSLLGSPGLVDYSLEPLHVLLDSQDPRREAL
RRALSQYLTDRARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQDCCPRQRGLAQLEVT
FIQAWGLWGDWFTATDAYVKVFFGGQELRTNTQWSNNNPIWSMPLDFGDVLLATGGPLRL
QVWDQDSGWDDDLLGTCDQAPKSGSHEARCNLKHGHLKFRYHARCLPHLGGGTCLDYVPQ
MLLGEPPGNRSGAVW
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctgcctgctcctcctgggcatccttctcctgctgctgcccctgccggtccct
gctccctgccacacagccacacgctcagagtgcaagcgcagccacaagtttgtgcccggt
gcatggctggccggggagggtgtggacgtgaccagcctccgccgctcgggctccttccca
gtagacacacaaaggttcctgcggcccgacggcacctgcaccctctgtgaaaatgcccta
caggagggcaccctccagcgcctgcccctggcactcaccaactggcgggcccagggctct
ggctgccagcgccatgtaaccagggccaaagtcagctccactgaagctgtggcccgggat
gcggctcgtagcatccgcaacgactggaaggtcgggctggatgtgactccccaccccgcc
ggcaacgtgcatgtgtctgtggccggctcacactcacaggcagccaactttgcagcccag
aagacccaccaggaccagtacagcttcagcactgacacagtggagtgccgcttctacagt
taccatgtggtacacactcccccgctgcaccctgacttcaagagggccctcggggacctg
cccctccacttcaatgcctccacccagcccgcctacctcaggctcatctccaactacggc
acccacttcatccgggctgtggagctgggcggccgcatctcggccctcactgccctgcgc
acgtgtgaactggccctggaagggctcacggacgacgaggtggatgactgcctgaacgtc
gaggcccaggtcaacataggcgcccgcggcagctcctctgccgaagccaaagcctgtgag
gagaagaagaagaagcacaagatgacggcctccttccaccaaacctaccgggagcgccat
tcggaagtggttggcggccatcacacctccattaacgacctgctgttcgggagccaggcc
gggcccgagcagtactcagcctgggtgaactcgctgctcggcagccctggcctggtggac
tacagcctggaacccctgcatgtgctgctggacagccaggacccgcggcgggaggcactg
aggagggccctgagtcagtacctgacggacagggctcgctggagggactgcagccggccg
tgcccaccggggcggcagaagagcccccgagacccgtgccagtgtgtgtgccatggctca
gcggtcaccacccaggactgctgccctcgacagaggggcctggcccagctggaggtgacc
ttcatccaagcgtggggcctgtggggggactggttcactgccacggatgcctatgtgaag
gtgttctttggtggccaggagctcaggacgaacacccagtggagcaataacaaccccatc
tggtcaatgccgctggattttggggatgtgctcctggccacaggggggcccctgaggttg
caggtctgggatcaggactctggctgggacgatgacctccttggcacctgtgatcaggct
cccaagtctggttcccatgaggcgagatgcaacctgaaacatggccacctgaaattccgc
tatcacgccaggtgcttgccccacctgggaggaggcacctgcctggactacgtcccccaa
atgcttctgggggagcctccaggaaaccggagtggggccgtgtggtga

DBGET integrated database retrieval system