KEGG   Macaca mulatta (rhesus monkey): 710314Help
Entry
710314            CDS       T01028                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    710314 (PAK2)
   04010 MAPK signaling pathway
    710314 (PAK2)
   04012 ErbB signaling pathway
    710314 (PAK2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    710314 (PAK2)
  Cellular commiunity
   04510 Focal adhesion
    710314 (PAK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    710314 (PAK2)
  Development
   04360 Axon guidance
    710314 (PAK2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    710314 (PAK2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     710314 (PAK2)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   710314 (PAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTETPAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSSVDGGAKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcccccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccccttgtcagccaatcacagtttgaaacctttg
ccctctgttccggaggagaagaagcccaggcacaaaatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gaacacaccatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaacatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctcaagttctacgactccaacacagtgaagcagaagtatctg
agctttactcctccggagaaagatggcttcccttctggaacaccagcactgaacgccaag
ggaacagaaacacccgcagtagtgacagaggaagatgatgatgatgaagagactgctcct
cctgttattgccccacgaccagatcatacgaaatcaatttacacacggtctgtaattgac
cccgttcctgcaccagttggtgattcaagtgttgatggtggtgccaagtcttcagacaaa
cagaaaaagaagactaaaatgacagatgaagaaattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgacgttgcattgggacaggaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaaaaatcccaacatagttaacttcttggacagttacctggtaggagatgaattgttt
gtggtcatggaataccttgctggtggatcgctcactgatgtggtaacagaaacctgcatg
gatgaagcacagattgctgctgtatgcagagagtgcttgcaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagcgacaatgtccttttgggaatggaagga
tcggttaagctcactgactttggtttctgtgcccagatcacccccgagcagagcaaacgc
agtaccatggtcggaaccccatactggatggcaccagaggtggttacacggaaagcttat
ggccccaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagagcttcagaatccagagaaactttccccaatatttcgagatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcttg
aaactggccaaaccattatctagcttgacaccactgatcatggcagctaaagaagcgatg
aagagtaaccgttaa

DBGET integrated database retrieval system