KEGG   Macaca mulatta (rhesus monkey): 710314Help
Entry
710314            CDS       T01028                                 

Gene name
PAK2
Definition
p21 protein (Cdc42/Rac)-activated kinase 2
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:mcc04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mcc04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mcc04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mcc04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mcc04510]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:mcc04660]
Organismal Systems; Development; Axon guidance [PATH:mcc04360]
Human Diseases; Cancers; Renal cell carcinoma [PATH:mcc05211]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGT
EKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTETPAVVTEEDDDDEETAP
PVIAPRPDHTKSIYTRSVIDPVPAPVGDSSVDGGAKSSDKQKKKTKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggagaactggaagacaagcccccagcacctcctgtgcgaatgagcagc
accatctttagcactggaggcaaagaccccttgtcagccaatcacagtttgaaacctttg
ccctctgttccggaggagaagaagcccaggcacaaaatcatctccatattctcaggcaca
gagaaaggaagtaaaaagaaagaaaaggaacggccagaaatttctcctccatctgatttt
gaacacaccatccatgttggctttgatgctgttactggagaattcactggcatgccagaa
cagtgggctcgattactacagacctccaacatcaccaaactagagcaaaagaagaatcct
caggctgtgctggatgtcctcaagttctacgactccaacacagtgaagcagaagtatctg
agctttactcctccggagaaagatggcttcccttctggaacaccagcactgaacgccaag
ggaacagaaacacccgcagtagtgacagaggaagatgatgatgatgaagagactgctcct
cctgttattgccccacgaccagatcatacgaaatcaatttacacacggtctgtaattgac
cccgttcctgcaccagttggtgattcaagtgttgatggtggtgccaagtcttcagacaaa
cagaaaaagaagactaaaatgacagatgaagaaattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatatacaagatatgaaaaaattggacaaggggcttct
ggtacagttttcactgctactgacgttgcattgggacaggaggttgctatcaaacagatt
aatttacagaaacagccaaagaaggaattgatcattaatgagattctggtgatgaaagaa
ttaaaaaatcccaacatagttaacttcttggacagttacctggtaggagatgaattgttt
gtggtcatggaataccttgctggtggatcgctcactgatgtggtaacagaaacctgcatg
gatgaagcacagattgctgctgtatgcagagagtgcttgcaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagcgacaatgtccttttgggaatggaagga
tcggttaagctcactgactttggtttctgtgcccagatcacccccgagcagagcaaacgc
agtaccatggtcggaaccccatactggatggcaccagaggtggttacacggaaagcttat
ggccccaaagtcgacatatggtctctgggtatcatggctattgagatggtagaaggagag
cctccatacctcaatgaaaatcccttgagggccttgtacctaatagcaactaatggaacc
ccagagcttcagaatccagagaaactttccccaatatttcgagatttcttaaatcgatgt
ttggaaatggatgtggaaaaaaggggttcagccaaagaattattacagcatcctttcttg
aaactggccaaaccattatctagcttgacaccactgatcatggcagctaaagaagcgatg
aagagtaaccgttaa

DBGET integrated database retrieval system