KEGG   Macaca mulatta (rhesus monkey): 710381Help
Entry
710381            CDS       T01028                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    710381 (EEA1)
   04145 Phagosome
    710381 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    710381 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 1411 aa AA seqDB search
MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EERSLREAAEQKVTHLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNEL
TQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSVSETSL
HRIHAELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHD
QVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKHLS
LEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEI
ISSGRMDLQXKSQALENIKQKLTKQEEEKKVLKQEFETLSQEAKIQHEELNNRIQTTVTE
LQKVKMEKEALMTELSTVKEKLSKVSDSLKHSKSEFEKENQKGKAAILDLEKTCKELKHQ
LQVQMDDTLREQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQKEKEEQQLQEN
INELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNN
YEKSQETFRQLQSDFYGKESELLATRQDLKSIEEKLSLAQEDLISNRNQIGNQNKLIQEL
KTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEI
TKLNEELKSHKQESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQV
KKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaggattttacagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagcaactcctataaacacagtggatgtcaataatgaaagctcttcagagggt
ttcatatgtccccagtgtatgaaatctcttggatctgctgatgaacttttcaaacattat
gaagctgttcatgatgctggtaatgactcaggtcatggaggagagtctaatcttgctttg
aagcgagatgatgtaacactgctcagacaagaggtccaagacctacaggcttcacttaag
gaagaaaaatggtactcggaagaattaaagaaggaattagaaaaatatcaagggctgcag
cagcaagaggctaaacctgatgggttggtgactgattcatcagcagaactacagtctttg
gaacagcaattagaagaagcccaaacagaaaattttaatattaagcaaatgaaagactta
tttgaacagaaagcagcccaacttgctactgaaattgcagatataaagtcaaagtatgat
gaagaaaggagtctccgagaagctgctgaacaaaaagtgacacatctgacagaagaatta
aacaaagaggcaactgtaattcaagatctgaagacggaactgcttcagagacctggtata
gaagatgttgctgtgctaaagaaggaactggtgcaagttcaaacactaatggataatatg
accttggaacgtgagcgagaatctgaaaaactcaaagacgaatgcaaaaaattacagtca
caatatgctagctcagaggccacaataagccagctaaggagtgaacttgccaaaggcccc
caggaagttgctgtatatgtacaggaactacaaaaactgaaaagttcagttaatgaatta
acacaaaaaaatcagaccttgacagagaacttgctgaaaaaagaacaagactatactaag
ttagaggagaaacataatgaagaatctgtgagtaaaaagaatattcaggcaacccttcat
caaaaagacctagattgtcagcagcttcagtcaagattgtctgtatctgaaacctcactg
catagaatacatgcagaactaagtgaaaaaggagaagctactcaaaagctcaaagaagaa
ttatctgaggtagagaccaagtaccagcatctaaaggcggagtttaagcagctacaacaa
cagagagaagaaaaagagcagcatgggttacaactccaaagtgaaattaatcaattacat
agcaaacttctggagacagagcgccaactaggggaagctcatggtaggctaaaggaacaa
agacagctttcaagtgaaaagttgatggataaagaacaacaagtggctgatttacaactc
aaactttctcggttagaagagcagttgaaggaaaaagttacaaattctacagaattgcag
catcaattagataaaacaaagcaacagcatcaagaacaacaggctcttcagcaaagcacc
acggcaaaacttcgagaagctcagaatgatttggaacaagttctacgtcaaattggcgat
aaggaccaaaagatccagaaccttgaagctttattacagaagagtaaagaaaatatttca
ttactagaaaaggaaagagaagatctttatgcaaaaattcaggctggtgaaggagagact
gctgttcttaaccagttacaagaaaaaaaccatacactgcaggagcaagtaactcaacta
acagagaagctgaagaatcagtcagaaagccataaacaagcccaggagaatttgcacgac
caggtacaagagcagaaggcacatcttagagctgcacaagaccgtgtcctttctctagaa
accagtgtcaatgaattaaatagtcaattaaatgaaagcaaggagaaggtctcccagctt
gacatacagattaaagccaaaaccgaactgttgctatcagcagaagcagcaaaaactgcc
caaagagctgatcttcagaatcatttggacacagctcaaaatgcattacaagataaacag
caggagttaaataagattactactcagttggatcaggtcactgcaaagttacaagacaag
caagaacattgcagtcagctggaaagtcatcttaaagaatataaagagaaacacctctct
ttagaacagaaaactgaagagctagaaggtcaaattaagaaactagaagctgatagtctc
gaagttaaagcaagcaaggagcaggctttgcaagatctacaacagcaaagacagctgaac
acagatttagagcttagagccacagaattgagtaaacaacttgaaatggagaaagaaatt
atctctagtggcagaatggatcttcagnaaaaatctcaagcccttgaaaatatcaagcaa
aagcttaccaagcaagaggaagaaaaaaaagtcctgaaacaggaatttgaaactttaagt
caagaagcaaagattcagcacgaggaattgaataacagaattcaaacaacagtaacagaa
ctacaaaaagtgaaaatggagaaagaagctttaatgacagagctttctacagtaaaggag
aaactgtcaaaagtttctgattctttgaaacactccaaaagtgaatttgaaaaggagaat
cagaaaggaaaagccgctatattagacttggagaaaacttgcaaagaattaaagcatcaa
cttcaagtgcagatggacgacacacttagggaacagaaggaactgaaaaagtcacttgaa
aaagagaaggaggcttctcatcagttgaaattggaactcaattcaatgcaggaacaactt
atacaggcccagaatactttaaaacaaaaggaaaaagaagagcaacaacttcaggagaac
ataaatgagctaaagcaatcaagtgaacagaagaaaaaacaaattgaagcactccaagga
gagcttaaaattgctgttttacagaagacagagcttgagaataaactacagcagcagtta
acacaggcagcccaggaacttgcagcagagaaagagaaaatatcagtattacaaaacaac
tatgaaaaaagtcaggaaactttcagacagcttcagtctgatttctatgggaaggaatct
gaacttctagccaccaggcaagatcttaagtccatagaagagaagctttctctagcacag
gaggacttgatttcaaacagaaatcaaattggaaatcaaaataaattgattcaagaacta
aagactgccaaggctacattggagcaggattcagcaaagaaagaacagcaattgcaggag
cgatgtaaagcactacaagacattcagaaagaaaagtcactgaaagaaaaagaactagta
aatgaaaagtctaaattggcagagatagaagaaattaaatgtaggcaagaaaaagaaatc
actaaactaaatgaagaactcaagtcccacaaacaagaaagcataaaggagataacaaat
cttaaggatgctaaacagcttctaattcagcagaaattagaacttcaaggaaaagcagac
tccctgaaggcagctgttgagcaggagaagagaaatcagcagatactaaaagaccaggtg
aaaaaggaagaagaggaactgaagaaagaatttattgagaaagaagctaagttgcattct
gaaataaaagaaaaggaagtaggaatgaagaagcatgaagaaaatgaggctaaacttacc
atgcagattacagcattaaatgaaaacttaggcactgtgaagaaggagtggcaatctagt
caacggagagttagtgagctcgagaaacaaacggatgacttacggggtgaaattgcagta
ttagaagcaacggttcagaataatcaagatgaaaggagagcactactggaaagatgtctt
aaaggagaaggtgaaatagaaaagcttcaaaccaaagtattagaattgcaaagaaagttg
gataatacaactgcagcagtgcaggagctgggcagagaaaaccaatcacttcagatcaaa
catacacaagcgttgaatagaaagtgggccgaagacaatgaagtacaaaactgtatggcc
tgtgggaaaggcttttcagtaacagtgagacggcatcactgccgacagtgtggaaatatc
ttctgtgctgaatgttcagccaaaaatgccttaactccttcttctaagaagcctgttcgt
gtgtgtgatgcatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system