KEGG   Macaca mulatta (rhesus monkey): 710385Help
Entry
710385            CDS       T01028                                 

Gene name
CYP1B1
Definition
cytochrome P450, family 1, subfamily B, polypeptide 1 (EC:1.14.14.1)
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Ovarian steroidogenesis
Chemical carcinogenesis
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    710385 (CYP1B1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    710385 (CYP1B1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    710385 (CYP1B1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    710385 (CYP1B1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    710385 (CYP1B1)
   05204 Chemical carcinogenesis
    710385 (CYP1B1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     710385 (CYP1B1)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP1 family
   710385 (CYP1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 542 aa AA seqDB search
MGTGLSPKDPWPLNLLSTQQTTLLLLLSVLVAVHVGQWLLRQRRRQLGSTPPGPFAWPLI
GNAAAVGQASHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPSF
ASFRVISGGRSMAFGHYSEHWKVQRRAAHSTMRNFSTRQLRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPMRTAFREFEQLNRNFSNFVLDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAARDSDDGGARLDLENVPATVTDIFGASQDTLSTALQWLLLLFIRYPDVQARVQAEL
DQVVGRDRLPCMDDQPNLPYVLAFLYEAMRFSSFVPVTIPHATNANTSVLGYHIPKDTVI
FVNQWSVNHDPVKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCNFRANPNGPEMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQKLQAEET
CQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccggcctcagtccgaaggacccttggcctctaaacctgctgtccacccagcag
accacgctcctgctactcctgtcggtgctggtcgctgtgcatgtgggccagtggctgctg
aggcagcggaggcggcagctcgggtccacgccccccggcccgtttgcttggccactgatc
ggaaacgcggcggcggtgggccaggcgtctcacctctcgttcgcgcgcctggcgcggcgc
tacggcgacgtcttccagatccgcctgggaagctgccccatagtggtgcttaatggcgag
cgcgccatccaccaggctctggtgcagcagggctcggccttcgccgaccggccgtccttt
gcctccttccgtgtgatttccggcggccgcagcatggctttcggccactactcggagcac
tggaaggtgcagcggcgcgcagcccacagcacaatgcgcaacttctccacgcgccagctg
cgcagccgccaagtcctcgagggccacgtgctgagcgaggcgcgcgagctggtggcgttg
ctggtgcgcggcagcgcggacggcgccttcctcgacccgaggccgctgaccgtcgtggcc
gtggccaacgtcatgagtgccgtgtgtttcggctgccgctacagccacgacgaccccgag
ttccgtgagctgctcagccacaacgaggagtttgggcgcacggtgggcgcgggcagtctg
gtggatgtgatgccctggctgcagtacttccccaacccgatgcgcaccgccttccgcgaa
ttcgagcagctcaaccgcaacttcagcaacttcgtcctggacaagttcttgaggcactgt
gaaagccttcggcccggggccgccccccgcgacatgatggacgcctttatcctctctgcg
gaaaagaaggcggccagggactcagacgatggtggcgcgcgactggatttggagaacgtg
ccggccactgtcactgacatcttcggcgccagtcaggacaccctgtccaccgcgctgcag
tggctgctcctcctcttcatcaggtatcctgatgtgcaggctcgagtgcaggcagaattg
gatcaggtcgtggggagggaccgtctaccttgtatggatgaccagcccaacctgccttat
gtcctggccttcctttatgaagccatgcgcttctccagctttgtgcctgtcaccattcct
catgccaccaatgccaacacctctgtcttgggctaccacattcccaaggacaccgtgatt
tttgtcaaccagtggtctgtgaatcatgacccagtgaagtggcctaacccggagaacttt
gatccagctcgattcttggacaaggatggcctcatcaacaaggacctgaccagcagagtg
atgattttttcagtgggcaaaaggcggtgcatcggtgaagaactgtctaagatgcagctt
tttctcttcatctccatcctggctcaccagtgcaatttcagggccaacccaaatggccct
gaaatgaatttcagttatggtctgaccattaaacccaagtcatttaaagtcaacgtcact
ctcagagagtccatggagctccttgatagtgctgtccaaaagttacaagctgaggaaact
tgccaataa

DBGET integrated database retrieval system