KEGG   Macaca mulatta (rhesus monkey): 710410Help
Entry
710410            CDS       T01028                                 

Gene name
ARG1
Definition
(RefSeq) arginase, liver
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    710410 (ARG1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    710410 (ARG1)
   00330 Arginine and proline metabolism
    710410 (ARG1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    710410 (ARG1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     710410 (ARG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 322 aa AA seqDB search
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLEEQECDVKDYGDLSFADIPN
DSPFQIVKNPRSVGKATEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHASVHPDLGV
IWVDAHTDINTPLTTTTGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAII
LACFGVAREGNHKPIDYLNPPK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctaagtccagaaccattgggattattggagctcctttctcaaagggacagcca
cgaggaggggtggaagaaggccctacagtattgagaaaggctggtctgcttgagaaactt
gaagaacaagagtgtgatgtgaaggattatggggacctgtcctttgctgacatccctaat
gacagtccctttcaaattgtgaagaatccaaggtctgtgggaaaagcgactgaacagctg
gctggcaaggtggcagaagtcaagaagaatggaagaatcagcctggtgctgggtggagac
cacagtttggcaattggaagcatctctggccatgccagcgtccaccctgatctcggagtc
atctgggtggatgctcacactgatatcaacactccactgacaaccacaactggaaacttg
catggacaacctgtatctttcctcctgaaggaactaaaaggaaagattcccgatgtgcca
ggattctcctgggtgacgccctgcatatctgccaaggatattgtgtatattggcttgaga
gacgtggaccctggggaacactacattttgaaaactctaggcattaaatacttttcaatg
actgaagtggacagactgggaattggcaaggtgatggaagaaacactcagctatctacta
ggaagaaagaaaaggccaattcatctgagttttgatgttgatggactggacccatctttc
acaccagctactggcacaccagtcgtgggaggtctgtcatacagagaaggtctctacatc
acggaagaaatctacaaaacagggctactttcgggattagatataatggaagtgaaccca
tccctggggaagacaccagaagaagtaactcgaacagtgaacacagcagtagcaataatc
ttggcttgctttggagttgctcgggagggtaatcacaagcctattgactaccttaaccca
cctaagtaa

DBGET integrated database retrieval system