KEGG   Macaca mulatta (rhesus monkey): 710412Help
Entry
710412            CDS       T01028                                 

Gene name
UGT2B15
Definition
UDP glucuronosyltransferase 2 family, polypeptide B15
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    710412 (UGT2B15)
   00053 Ascorbate and aldarate metabolism
    710412 (UGT2B15)
   00500 Starch and sucrose metabolism
    710412 (UGT2B15)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    710412 (UGT2B15)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    710412 (UGT2B15)
   00860 Porphyrin and chlorophyll metabolism
    710412 (UGT2B15)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    710412 (UGT2B15)
   00982 Drug metabolism - cytochrome P450
    710412 (UGT2B15)
   00983 Drug metabolism - other enzymes
    710412 (UGT2B15)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    710412 (UGT2B15)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     710412 (UGT2B15)
Glycosyltransferases [BR:mcc01003]
 Others
  Hydrophobic molecule
   710412 (UGT2B15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 530 aa AA seqDB search
MSLKWTSVFLLLQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVRRRHEVTVLTSSA
STFVNDSKSSAIKFEVYPTSLTKNDMEDSLMKLLDIWTYSISNSTFLSYFSKLQELCWEY
YYYSEKLCKDAVLNKKLMTKLKETKFDVILADALNPCGELLAELFNIPFVYSLRFTVGYT
FEKNGGGFLFPPSYVPVVMSELSDQMTFTERIKNMIHKLYFDFWFQIHDIKRWDQFYSEV
LGRPTTLFETMRKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
GENGVVVFSLGSMISNMSEERANMIASALAQIPQKVLWKFDGKKPNTLGSNTRLYKWLPQ
NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFAEQHDNIVHMKVKGAALSVDIRT
MSSRDLLNALKSVINEPIYKENAMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVA
AHNLTWIQYHSLDVIAFLLACVAAVIFIITKCCLFCFRKLAKTGKKKKWD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaaatggacgtcagtctttctgctgttacaactcagttgttattttagctct
gggagttgtggaaaggtgctggtgtggcccacagaatacagccattggataaatatgaag
acaatcctggaagagcttgttcggagacgtcatgaggtgactgtgttgacatcctcggct
tctacttttgtcaatgacagtaaatcatctgctattaaatttgaagtttatcctacatct
ttaactaaaaatgatatggaagattctcttatgaaactgctagatatttggacatatagt
atttcaaacagtacatttttgtcgtatttttccaaactacaagaattgtgttgggaatat
tattactatagtgaaaagctctgtaaagatgcagttttgaacaagaaacttatgacaaaa
ctaaaagagacaaagtttgatgttattctggcagatgcccttaatccctgtggggagcta
ctggctgagctatttaacataccctttgtgtacagcctccgcttcactgttggctacaca
tttgagaagaatggtggaggatttctgttccctccttcctatgtacctgttgttatgtca
gaattaagtgatcaaatgactttcacagagaggataaaaaatatgatacataagctttat
tttgacttttggtttcaaatccatgatataaagaggtgggaccagttttacagcgaagtt
ctaggaagacccactacattatttgagacaatgaggaaagctgaaatgtggctcattcga
acctattgggattttgaatttcctcgcccattcttaccaaatgttgattttgttggagga
cttcactgtaaaccagccaaacccctgcctaaggaaatggaagagtttgtccagagctct
ggagaaaatggtgttgtggtgttttctctggggtcgatgatcagtaacatgtcagaagaa
agggccaacatgattgcatcagcccttgcccagatccctcaaaaggttctatggaaattt
gatggcaagaagccaaatactttaggctccaatactcgactgtacaagtggttaccccag
aatgaccttcttggtcatcccaaaaccaaagcttttataactcacggtggaaccaatggc
atctatgaggcgatctaccatgggatccctatggtgggcattcccttgtttgcggaacaa
catgataacattgttcacatgaaagtcaagggagcagccctcagtgtggacatcaggacc
atgtcaagtagagatttgctcaacgcattgaagtcagtcattaatgagcctatctataaa
gagaatgccatgaaattatcaagaattcatcatgatcaaccaatgaagcccctggatcga
gcagtcttctggattgagtttgttatgcgccacaaaggagccaagcaccttcgggtcgca
gctcacaacctcacctggatccagtaccactctttggatgtgatagcattcctgctggcc
tgcgtggcagctgtgatatttatcatcacaaaatgttgcctgttttgcttccgaaagctt
gccaaaacaggaaagaagaagaaatgggattag

DBGET integrated database retrieval system