KEGG   Macaca mulatta (rhesus monkey): 710441Help
Entry
710441            CDS       T01028                                 

Definition
sphingosine kinase 1-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mcc00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:mcc04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mcc04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:mcc04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:mcc05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 551 aa AA seqDB search
MSAQVLGFLRSWAPLPLAAPRDPAAAGNDAGAPTATAPDGEGEPHSRPCDARLGSTDKEL
KAGAAATGSAPTAPGTPRQREPRVEVMDPAGGPRGVLPRSCRVLVLLNPRGGKGKALQLF
RSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMSGDGLMHEVVNGLMER
PDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTRLLCRRLLSPMNLLS
LHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLP
VGRAGSKTPVSPVVVQQGPVDAHLVPLEEPVPSHWTVVPDQDFVLVLALLHSHLGSEMFA
APMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYMPVVAWRLQPLEG
CSKLALKEHTTSQEEARGLLQDRKYKRHESPRRPSPSGLSLQFVSEGLTGTGPESPAAGP
GTPTSDLRRDSKGASAGTFCWGDKWKIGNRVPIFFATGDPPVESSLQNRNGGISTHFLHF
SIKLTLGRRGQ
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcaagttctgggatttttacgcagctgggctccccttcccctggcagccccg
agggatccagccgccgcagggaatgacgccggtgctcctacagccacggctccggacggg
gagggcgagccccacagccggccctgcgacgcccgcctgggcagcaccgataaggagctg
aaggcaggagccgccgccacgggcagtgccccgacagcgccagggaccccccggcagagg
gagccacgggtcgaggttatggatccagcgggcggcccccggggcgtgctcccgcggtcc
tgccgcgtgctggtgctgctgaacccgcgtggcggcaagggcaaggccctgcagctcttc
cggagtcacgtgcagccccttttggctgaggctgaaatctccttcacgctgatgctcact
gagcggcggaaccatgcgcgggagctggtgcggtcggaggagctgggccgctgggacgct
ctggtggtcatgtctggagacggactgatgcacgaggtggtgaacgggctcatggagcgg
cctgactgggagaccgccatccagaagcccctgtgtagcctcccagcaggctctggcaac
gcgctggcagcttccttgaaccattatgctggctatgagcaggtcaccaatgaagacctc
ctgaccaactgcacgcggttgctgtgccgccggctactgtcacccatgaacttgctgtct
ctgcacacggcttcggggctgcgcctcttctctgtgctaagcctggcctggggcttcatt
gctgatgtggacctagagagtgagaagtatcggcgcctgggggagatgcgcttcactctg
ggcaccttcctgcgtctggcagccctgcgcacttaccgtggccgactggcctacctccct
gtaggaagagccggctctaagacacctgtttctcccgttgtggtccagcagggccccgta
gatgcacaccttgtgccattggaggagccagtgccctctcactggacagtggtgcccgac
caggatttcgtgctggtgctagcgctgctgcactcgcacctgggcagcgagatgtttgcg
gcacccatgggccgctgtgcagctggtgtcatgcatctgttctatgtgcgggcgggagtg
tctcgggccatgctgctgcgcctcttcctggccatggagaagggcaggcatatggaatat
gaatgcccttacttggtatacatgcctgtggtcgcctggagactacagccactggaaggc
tgctctaagctggctcttaaggagcacaccaccagccaggaagaggccagaggactgctc
caggacaggaagtacaaaaggcatgagagcccccgccggccgtccccttctggattgagc
ctgcagtttgtaagcgaagggctgacaggcaccggcccagagagccccgcggcaggccct
ggaacacccacctctgacctgagaagggacagcaagggagcaagtgccgggacattctgc
tggggtgacaaatggaaaatcggcaatagggttccgattttctttgccacgggggaccca
cctgttgaaagctcgcttcagaatagaaacggcggcatctcaacacacttcttgcacttc
agcatcaaactcaccttggggagaagagggcaatga

DBGET integrated database retrieval system