KEGG   Macaca mulatta (rhesus monkey): 710441Help
Entry
710441            CDS       T01028                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    710441 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    710441 (SPHK1)
   04020 Calcium signaling pathway
    710441 (SPHK1)
   04071 Sphingolipid signaling pathway
    710441 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    710441 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    710441 (SPHK1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     710441 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
16
AA seq 485 aa AA seqDB search
MRERATPRAWSRDLVGPSPPLGAAAPDSASAVFSTSDPAAAGNDAGAPTATAPDGEGEPH
SRPCDARLGSTDKELKAGAAATGSAPTAPGTPRQREPRVEVMDPAGGPRGVLPRSCRVLV
LLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHARELVRSEELGRWDALVVMS
GDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCT
RLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLR
LAALRTYRGRLAYLPVGRAGSKTPVSPVVVQQGPVDAHLVPLEEPVPSHWTVVPDQDFVL
VLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYL
VYMPVVAFRLEPEDGRGVFTVDGELMVSEAVQGQVHPNYFWMVSECVEPLPSWKPQQTPP
PEEPL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcgggagcgcgcaactccccgcgcgtggtcccgggatttagtcgggccctccccgcct
ttgggagctgcggccccggactccgccagcgctgtcttctctacctcagatccagccgcc
gcagggaatgacgccggtgctcctacagccacggctccggacggggagggcgagccccac
agccggccctgcgacgcccgcctgggcagcaccgataaggagctgaaggcaggagccgcc
gccacgggcagtgccccgacagcgccagggaccccccggcagagggagccacgggtcgag
gttatggatccagcgggcggcccccggggcgtgctcccgcggtcctgccgcgtgctggtg
ctgctgaacccgcgtggcggcaagggcaaggccctgcagctcttccggagtcacgtgcag
ccccttttggctgaggctgaaatctccttcacgctgatgctcactgagcggcggaaccat
gcgcgggagctggtgcggtcggaggagctgggccgctgggacgctctggtggtcatgtct
ggagacggactgatgcacgaggtggtgaacgggctcatggagcggcctgactgggagacc
gccatccagaagcccctgtgtagcctcccagcaggctctggcaacgcgctggcagcttcc
ttgaaccattatgctggctatgagcaggtcaccaatgaagacctcctgaccaactgcacg
cggttgctgtgccgccggctactgtcacccatgaacttgctgtctctgcacacggcttcg
gggctgcgcctcttctctgtgctaagcctggcctggggcttcattgctgatgtggaccta
gagagtgagaagtatcggcgcctgggggagatgcgcttcactctgggcaccttcctgcgt
ctggcagccctgcgcacttaccgtggccgactggcctacctccctgtaggaagagccggc
tctaagacacctgtttctcccgttgtggtccagcagggccccgtagatgcacaccttgtg
ccattggaggagccagtgccctctcactggacagtggtgcccgaccaggatttcgtgctg
gtgctagcgctgctgcactcgcacctgggcagcgagatgtttgcggcacccatgggccgc
tgtgcagctggtgtcatgcatctgttctatgtgcgggcgggagtgtctcgggccatgctg
ctgcgcctcttcctggccatggagaagggcaggcatatggaatatgaatgcccttacttg
gtatacatgcctgtggtcgccttccgcttagagcccgaggatgggagaggtgtgtttaca
gtggatggggaattgatggttagcgaggctgtgcagggccaggtgcacccaaactacttc
tggatggtcagtgagtgcgtggagcccctgcccagctggaagccccagcagacgccacct
ccagaagagcccttatga

DBGET integrated database retrieval system