KEGG   Macaca mulatta (rhesus monkey): 710521Help
Entry
710521            CDS       T01028                                 

Gene name
NDUFB8
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B8
  KO
K03964  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00190  Oxidative phosphorylation
mcc01100  Metabolic pathways
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc05010  Alzheimer's disease
mcc05012  Parkinson's disease
mcc05016  Huntington's disease
Module
mcc_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    710521 (NDUFB8)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    710521 (NDUFB8)
  Environmental adaptation
   04714 Thermogenesis
    710521 (NDUFB8)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    710521 (NDUFB8)
   05012 Parkinson's disease
    710521 (NDUFB8)
   05016 Huntington's disease
    710521 (NDUFB8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    710521 (NDUFB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B8
Motif
Other DBs
NCBI-GeneID: 710521
NCBI-ProteinID: NP_001252695
UniProt: F7H444
Position
9
AA seq 186 aa AA seqDB search
MAVARAGVLGVQWLQRASRNVVPLGARTASRMTKDMLPGPYPRTPEERAAAAKKYNMRVE
DYEPYPDEGMGYGDYPKLPDRSQHERDPWYSWDQPDLRLNWGEPMHWHIDMYTRNRVDTS
PTPVSWNVMCMHLFGFLAFMTFMFWVGDVYPSYQPVGPKQYPYNNLYLERGGDPSKEPEL
VVHYEI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccagggccggggtcctgggagttcagtggctgcaaagggcatcccggaac
gtggtgccgctgggcgcacggacagcctcccgcatgaccaaggacatgttgccagggccc
tatcctaggaccccagaagaacgggccgccgccgccaagaagtataatatgcgtgtggaa
gactacgagccttacccggatgagggcatggggtatggcgactacccgaagctccctgac
cgttcacagcatgagagggatccatggtatagctgggaccaaccggacctgaggttgaac
tggggtgaaccgatgcactggcacatagacatgtacaccaggaaccgtgtggatacatcc
cccacacctgtttcttggaatgtcatgtgtatgcacctcttcggtttcctggctttcatg
acattcatgttctgggtgggggacgtgtacccttcctaccagcctgtgggaccaaagcag
tatccttacaataatctgtacctggaacgaggcggcgatccctccaaagaacctgagctg
gtggttcactatgagatctga

DBGET integrated database retrieval system