KEGG   Macaca mulatta (rhesus monkey): 710521Help
Entry
710521            CDS       T01028                                 

Gene name
NDUFB8
Definition
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
Orthology
K03964  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    710521 (NDUFB8)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    710521 (NDUFB8)
   05012 Parkinson's disease
    710521 (NDUFB8)
   05016 Huntington's disease
    710521 (NDUFB8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    710521 (NDUFB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 186 aa AA seqDB search
MAVARAGVLGVQWLQRASRNVVPLGARTASRMTKDMLPGPYPRTPEERAAAAKKYNMRVE
DYEPYPDEGMGYGDYPKLPDRSQHERDPWYSWDQPDLRLNWGEPMHWHIDMYTRNRVDTS
PTPVSWNVMCMHLFGFLAFMTFMFWVGDVYPSYQPVGPKQYPYNNLYLERGGDPSKEPEL
VVHYEI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccagggccggggtcctgggagttcagtggctgcaaagggcatcccggaac
gtggtgccgctgggcgcacggacagcctcccgcatgaccaaggacatgttgccagggccc
tatcctaggaccccagaagaacgggccgccgccgccaagaagtataatatgcgtgtggaa
gactacgagccttacccggatgagggcatggggtatggcgactacccgaagctccctgac
cgttcacagcatgagagggatccatggtatagctgggaccaaccggacctgaggttgaac
tggggtgaaccgatgcactggcacatagacatgtacaccaggaaccgtgtggatacatcc
cccacacctgtttcttggaatgtcatgtgtatgcacctcttcggtttcctggctttcatg
acattcatgttctgggtgggggacgtgtacccttcctaccagcctgtgggaccaaagcag
tatccttacaataatctgtacctggaacgaggcggcgatccctccaaagaacctgagctg
gtggttcactatgagatctga

DBGET integrated database retrieval system