KEGG   Macaca mulatta (rhesus monkey): 710521Help
Entry
710521            CDS       T01028                                 

Gene name
NDUFB8
Definition
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
Orthology
K03964  
NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Oxidative phosphorylation
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:mcc00190]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:mcc05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:mcc05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mcc05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:mcc04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 186 aa AA seqDB search
MAVARAGVLGVQWLQRASRNVVPLGARTASRMTKDMLPGPYPRTPEERAAAAKKYNMRVE
DYEPYPDEGMGYGDYPKLPDRSQHERDPWYSWDQPDLRLNWGEPMHWHIDMYTRNRVDTS
PTPVSWNVMCMHLFGFLAFMTFMFWVGDVYPSYQPVGPKQYPYNNLYLERGGDPSKEPEL
VVHYEI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccagggccggggtcctgggagttcagtggctgcaaagggcatcccggaac
gtggtgccgctgggcgcacggacagcctcccgcatgaccaaggacatgttgccagggccc
tatcctaggaccccagaagaacgggccgccgccgccaagaagtataatatgcgtgtggaa
gactacgagccttacccggatgagggcatggggtatggcgactacccgaagctccctgac
cgttcacagcatgagagggatccatggtatagctgggaccaaccggacctgaggttgaac
tggggtgaaccgatgcactggcacatagacatgtacaccaggaaccgtgtggatacatcc
cccacacctgtttcttggaatgtcatgtgtatgcacctcttcggtttcctggctttcatg
acattcatgttctgggtgggggacgtgtacccttcctaccagcctgtgggaccaaagcag
tatccttacaataatctgtacctggaacgaggcggcgatccctccaaagaacctgagctg
gtggttcactatgagatctga

DBGET integrated database retrieval system