KEGG   Macaca mulatta (rhesus monkey): 710527Help
Entry
710527            CDS       T01028                                 

Definition
NADH-cytochrome b5 reductase 2-like
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    710527
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     710527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 305 aa AA seqDB search
MLGVSLRDPSLLLTITVIGVTVLVLVLKSMNSRKREPITLQDPEAKYPLPLIEKEKISHN
TRRFRFELPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKN
VHPQYPEGGKMTQYLENMKIGDTIFFRGPKGRLFYHGPGNLGIRPDHMSEPKKKLAHHLG
MIAGGTGITPMLQLIRHITKDPSDSTRMSLIFANQTEEDILVRKELEEIARTHPDQFDLW
YTLDRPPIGWKYSSGFVTADMIKEHLPPPGKSTLILVCGPPPLIQTAAHPNLEKLGYTQD
MIFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgttgggcgtctcactccgggacccgtccctgctcctgaccatcaccgtcattggggtc
actgtgctcgtgttggtcctgaagagcatgaactccaggaagagagagcctatcacctta
caagaccctgaagccaagtacccgctgcctttgattgagaaagagaaaatcagccacaac
acccggaggttccgctttgaactgccttcgcctgaccatgtcttaggacttcctgtaggt
aactatgtccagctcttggcgaaaattgataatgaattggtggtcagggcttacacgcct
gtctctagtgatgatgacagaggctttgtggacttaattataaagatctacttcaaaaat
gtacacccccagtatcctgaaggggggaagatgactcagtatttggagaacatgaaaatc
ggggacaccatcttttttcgagggccaaagggacgcttgttttaccatgggccagggaat
cttggaatcagaccagaccacatgagtgagcctaaaaaaaaactggcccatcacctggga
atgattgctgggggcacaggcatcacacccatgttgcagctcattcgccacatcaccaag
gaccccagtgacagcaccaggatgtccctcatctttgccaaccagacagaggaggatata
ttggtcagaaaagagcttgaagaaattgccaggactcacccagaccagttcgacctgtgg
tacaccctggacaggcctcctattggctggaagtacagctcaggctttgttactgccgac
atgatcaaggagcaccttcctcctccagggaagtccacgctcatcctggtgtgtggccca
ccacccctgatccagacggcagctcaccctaacctggagaagctgggttatacccaggac
atgattttcacctactaa

DBGET integrated database retrieval system