KEGG   Macaca mulatta (rhesus monkey): 710693Help
Entry
710693            CDS       T01028                                 

Definition
ubiquitin carboxyl-terminal hydrolase 33-like
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     710693
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   710693
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1001 aa AA seqDB search
MAPALSLQSEQGAALGPRTWAWPRGPAPGTGSFRGSAPTSPDARDACGDPGDTGRSRGCC
GKSPVREADTPRAALRGRFPALLRRHCPSTRAEKEKRSLRRCGCRPLLVALAGPTGQAVE
VLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSHGTCQDCKVRGPNLWAC
LENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPSLP
HVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEVDEEDELRARGLTGLKNIGNTC
YMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTNLF
QGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQTITTEETMEEDKSQS
DVDFQSCESCSNSDKAENENGSRGFSEDNNETTMLIQDDENNSEMSKDWQKEKICNKINK
VNSEGELDKDRDSISETVDLNNQETVKVQIHSRASAQSASPKRKKQHKKYRSVISDIFDG
TIISSVQCLTCDRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQG
WIAFFMEYVKRFVVSCVPSWFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVK
FCKVQKFPEILCIHLKRFRHELMFSTKISTHVSFPLEGLDLQPFLAKDSPAQIVTYDLLS
VICHHGTASSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQK
ERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISNNDFLCIHGGVPPRKAGYIED
LVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQEE
DSPATFYCISMQWFREWESFVKGKDGDPPGPIDNTKIAVTKCGNVILRQGADSGQISEET
WNFLQSIYGGGPEVILRPPVVHVDPDILQAEEKIEVETRSL
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctgccctgagtttgcagtcagaacagggagccgccctgggtccccgcacctgg
gcctggccccgtggccccgcccctgggacgggctcctttcgaggctccgcccccacctcc
cctgacgcccgagacgcctgcggcgaccccggagacaccggaaggagccgtggctgctgc
gggaagtcgccggttcgggaggcggacaccccgagggcagcgctgcggggccgttttccg
gccctcctgaggcgacactgcccctctacgagggctgagaaggaaaagaggagcttgcgg
aggtgcggctgcaggccgctgctggtcgcgctggcgggtcccacaggccaggccgtggag
gtgttacctcattttgaaagtcttgggaaacaggaaaaaattcctaacaaaatgtcagct
tttcgaaatcattgtccacatttggattcagttggtgaaataacaaaagaagatttgata
caaaaatctcatggtacttgtcaggattgtaaagtccgaggaccgaatctttgggcatgc
ctggagaatagatgttcatatgttggctgtggtgaatcacaagtagatcacagcaccata
cattctcaggagacaaagcattatctaactgtgaaccttaccactcttcgagtatggtgt
tatgcttgcagcaaagaagtatttttggataggaaattaggaactcagccttcattgcct
catgtaagacaacctcaccaaatacaagaaaacagtgtccaggattttaaaatacccagt
aatacaacattaaaaactcctctggttgctgtatttgatgatctggatatagaagtggac
gaagaagatgaacttagggcaagaggtcttacaggtttgaaaaatattggaaatacttgt
tacatgaatgcagctttgcaggctctttctaattgcccacctttgacacagttttttctt
gattgtggaggattagcacgaacagataagaaacctgccatttgtaaaagttatctcaaa
ctaatgacagagctgtggcataaaagcaggccaggatctgttgtgcctactaatctgttt
caaggaattaaaactgtaaatccaacatttcgggggtattctcagcaggatgctcaagaa
ttccttcgatgtttaatggatctgcttcatgaagaattgaaagagcaagtcatggaagta
gaagaagatccgcaaaccataaccactgaggagacaatggaagaagacaagagccagtca
gatgtagattttcagtcttgtgaatcttgtagcaacagtgataaagcagaaaatgaaaat
ggctctagaggcttttctgaagataataatgaaacaacaatgttaattcaggatgatgaa
aacaattcagaaatgtcaaaagattggcaaaaagagaagatatgcaataagattaataaa
gtaaattctgaaggcgaattagataaagatagagactctatatctgaaacagttgactta
aacaaccaggaaactgtcaaagtgcaaatacacagcagagcttcagctcagtctgcatct
ccaaagagaaaaaaacagcacaagaaatatagaagtgttatttcagacatatttgatgga
acaatcattagttcagtgcagtgtctgacttgtgacagggtgtctgtaaccctcgagacc
tttcaagatctgtccttgccaattcctggcaaggaagaccttgctaagctgcattcatca
agtcatccaacttctatagtcaaagcaggatcatgtggcgaagcatatgctccacaaggg
tggatagcttttttcatggaatatgtgaagaggtttgttgtctcatgtgtccctagctgg
ttttggggtccagtagtaaccttgcaagattgtcttgctgccttctttgccagagatgaa
ctaaaaggtgacaatatgtacagttgtgaaaaatgcaaaaagttgagaaatggagtaaag
ttttgtaaagtacaaaagtttcctgagattttatgcatccaccttaaaagattcagacat
gaactaatgttttccaccaaaatcagtacccatgtttcatttccactggaaggcttggat
cttcagccatttcttgctaaggatagtccagctcaaattgtgacttatgatcttctgtca
gtcatttgccatcatggaactgcaagtagtggacactatatagcctactgccgaaacaat
ctaaataatctctggtatgaatttgatgatcagagtgtcactgaagtttcagaatctact
gtacaaaatgcagaagcttatgttcttttctataggaagagcagtgaagaggcacaaaaa
gagaggagaaggatatcaaatttgttgaacataatggaaccaagcctccttcagttttat
atttctcgacagtggctaaataaatttaagacctttgccgaacctggccctatttcaaat
aatgactttctttgtattcatggaggtgttcctccaagaaaagctggttatattgaagac
ctggttttgatgctgcctcagaacatttgggataacctatatagcaggtatggtggagga
ccagctgttaaccatctgtacatttgtcacacttgccaaattgaggcggagaaaattgaa
aaaagaagaaaaactgagctggaaatttttatccggcttaatagagcgttccaagaagag
gactctccagctactttttattgcatcagtatgcagtggtttagagaatgggaaagtttt
gtgaagggtaaagatggagatcctccaggtcctattgacaatactaagattgcagtcact
aaatgtggtaatgtgatacttaggcaaggagcagattctggccagatttctgaagaaaca
tggaattttctgcagtctatttatggtggaggtcctgaagttatcctgcgacctccagtt
gttcatgttgatccagatatacttcaagcagaagaaaaaattgaagtagaaactcggtct
ttgtaa

DBGET integrated database retrieval system