KEGG   Macaca mulatta (rhesus monkey): 710753Help
Entry
710753            CDS       T01028                                 

Gene name
PFN1, profilin-1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    710753 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    710753 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    710753 (PFN1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   710753 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 221 aa AA seqDB search
MRSPSRPWRRRRRGHTRRRPPVLPFGGGSGGARAAAQRAEPRSGRQRVSRALRLPPPASR
GSSSPARGPSSSAESSPSSSAMAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKT
FVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTF
NVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctccctcccggccttggcgcaggcgcaggcgcgggcacacgcgccgccgcccg
ccggtccttcccttcggcggaggaagtggcggtgcgagggctgctgcacagcgagcagag
ccgcggtccggacggcagcgcgtgtctcgagctctccgcctccccccgcccgccagccga
ggcagctcgagcccagcccgcggccccagcagcagcgccgagagcagccccagtagcagc
gccatggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggac
gcggccatcgtgggttacaaggactcgccctccgtctgggccgccgtccccgggaaaacc
ttcgtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttt
tacgtcaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctg
caggatggggagtttagcatggatcttcgtaccaagagcaccggtggggcccccaccttc
aatgtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtc
cacggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgctcccag
tactga

DBGET integrated database retrieval system