KEGG   Macaca mulatta (rhesus monkey): 710753Help
Entry
710753            CDS       T01028                                 

Gene name
PFN1, profilin-1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:mcc04015]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mcc04810]
Human Diseases; Infectious diseases; Salmonella infection [PATH:mcc05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 221 aa AA seqDB search
MRSPSRPWRRRRRGHTRRRPPVLPFGGGSGGARAAAQRAEPRSGRQRVSRALRLPPPASR
GSSSPARGPSSSAESSPSSSAMAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKT
FVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTF
NVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctccctcccggccttggcgcaggcgcaggcgcgggcacacgcgccgccgcccg
ccggtccttcccttcggcggaggaagtggcggtgcgagggctgctgcacagcgagcagag
ccgcggtccggacggcagcgcgtgtctcgagctctccgcctccccccgcccgccagccga
ggcagctcgagcccagcccgcggccccagcagcagcgccgagagcagccccagtagcagc
gccatggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggac
gcggccatcgtgggttacaaggactcgccctccgtctgggccgccgtccccgggaaaacc
ttcgtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttt
tacgtcaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctg
caggatggggagtttagcatggatcttcgtaccaagagcaccggtggggcccccaccttc
aatgtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtc
cacggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgctcccag
tactga

DBGET integrated database retrieval system