KEGG   Macaca mulatta (rhesus monkey): 710797Help
Entry
710797            CDS       T01028                                 

Definition
histone deacetylase 4-like
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    710797
  Substance dependence
   05034 Alcoholism
    710797
  Infectious diseases
   05169 Epstein-Barr virus infection
    710797
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     710797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 763 aa AA seqDB search
MFDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPA
LREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQ
ELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKA
LAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFPLRKTA
SEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGPSSPNN
SSGSVSAENGITPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPATGPAA
GTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLLEQPPA
QAPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPAQKEAHAPAGVQVKQEPIESDDEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPVSVLEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVSVPLMCK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatggactttctggccgagaccagccagtggagctgctgaatcctgcccgcgtg
aaccacatgcccagcacggtggatgtggccacggcactgcctctacaagtggccccctcg
gcagtgcccatggacctgcgcctggaccaccagttctcgctgcctgtggcagagcccgcc
ctgcgggagcagcagctacagcaggagctcctggcgctcaagcagaagcagcagatccag
aggcagatcctcatcgccgagttccagaggcagcacgagcagctctcccggcagcacgag
gcgcagctccacgagcacatcaagcaacagcaggagatgctggccatgaagcaccagcag
gagctgctggaacaccagcggaagctggagaggcaccgccaggagcaggagctggagaag
cagcaccgggagcagaagctgcagcagctcaagaacaaggagaagggcaaagagagtgcc
gtggccagcacagaagtgaagatgaagttacaagaatttgtcctcaataaaaagaaggca
ctggcccatcggaatctgaaccactgcatttccagcgacccccgctactggtacgggaaa
acgcagcacagttcccttgaccagagttctccaccccagagcggagtgtcaacctcctat
aaccacccagtcctgggaatgtacgacgccaaagatgacttccctcttaggaaaacagct
tctgaaccgaatctgaaattacggtccaggctaaagcagaaagtggccgaaagacggagc
agccctctgctacgcaggaaagacgggccagtggtcactgctctaaaaaagcgtccgttg
gatgtcacagattccgcgtgcagcagcgccccaggctctggacccagctcacccaacaac
agctccgggagcgtcagcgcagagaacggcatcacgcccgccgtccccagcatcccggcg
gagacgagtttggcgcacagacttgtggcgcgagaaggctcggccgctccacttcccctc
tacacgtcgccgtccctgcccaacatcacgctgggcctgcctgccaccggccctgctgct
ggcacggcgggccagcaggatgccgagagactcacccttcccgccctccagcagcgactc
tcccttttccccggcacccacctcactccctacctgagcacctcgcccttggagcgggac
ggaggggcagcgcacagccctcttctgcagcacatggtcttactggagcagccgccggca
caagcgcccctcgtcacagactggtatctttcaggcctgggagcactgcccctccacgca
cagtccttggttggtgcggaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccgctggggcgaacccagtcggccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacacaagcagcagttccagcagcag
caactgcacatgaacaagatcatcccgaaaccaagcgagccggcccggcagccggagagt
cacccagaggagacggaggaggagctccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccggcgcagaaggaggcgcacgcaccagctggcgtgcaggtgaagcag
gagcccattgagagcgatgacgaagaggcagagccccctcgggaggtggagccgggccag
cgccagcccagtgagcaggagctgctcttcagacagcaagccctcctgctggagcagcag
cggatccaccagctgaggaactaccaggcgtccatggaggctgccggcattcccgtgtcc
ttcggcagccacaggcctctgtcccgggcgcagtcctcaccggcatctgccacctttccc
gtgtctgtgctggagccccccaccaagccgaggttcacgacaggcctcgtgtatgacacg
ctgatgctgaagcaccagtgcacctgcgggagcagcagcagccaccccgagcacgccggg
aggattcagagcatctggtcccgcctgcaggagacaggcctccggggcaaatgcgagtgc
atccgcggacgcaaggccaccctggaggagctgcagacggtgcactcggaagcccacacc
ctcctgtacggcacaaatcccctcaaccggcagaaactggacagtaagaaacttctaggc
tcgctcgcctccgtgttcgtccggctcccctgcggtggtgttggggtaagtgttccttta
atgtgtaaataa

DBGET integrated database retrieval system