KEGG   Macaca mulatta (rhesus monkey): 710930Help
Entry
710930            CDS       T01028                                 

Gene name
DLAT
Definition
dihydrolipoamide S-acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    710930 (DLAT)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    710930 (DLAT)
   00020 Citrate cycle (TCA cycle)
    710930 (DLAT)
   00620 Pyruvate metabolism
    710930 (DLAT)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     710930 (DLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 647 aa AA seqDB search
MWRVCARRAQNVAPWAGLEARWTALQEVPGTPRVSSRFGPAPARRNSATTGYGGVRALCG
WTPSSGATPRNRLLLQLLGSPGRRCYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGDKIN
EGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYT
LDSSPAPTPQAAPAPTPAATASPPIPSAQAPGSSYPPHMQVLLPALSPTMTMGTVQRWEK
KVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADI
SAFADYRPTEVTDLKPQAPPPTPPPVATVPPTPQPLAPTPSAPCPATPAGPKGRVFVSPL
AKKLAVEKGIDLTQVKGTGPDGRITKKDIDSFVPSKAAPAPAAVVPPTGPGMAPVPTGVF
TDIPISNIRRVIAQRLMQSKQTIPHYYLSIDVNMGEVLLVRKELNKILEGRSKISVNDFI
IKASALACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIAND
VVSLAAKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPA
DNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPVTMLL
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtctgtgcgcgacgggcccagaatgtagccccatgggcgggactcgaggct
cggtggacggccttgcaggaggtacccggaactccacgagtgtcctcgcgatttggcccg
gctccggctcgtcgcaacagcgcgactacagggtatggaggggtccgggcactgtgcggc
tggacccccagctctggggccacgccgcggaaccgcctactgctgcagcttttggggtcg
cccggccgccgctgttacagtcttcccccgcatcagaaggttccattgccttctctttcc
cccacaatgcaggcaggcactatagcccgttgggaaaaaaaagagggggacaaaatcaac
gaaggtgacctaattgcagaagttgaaactgataaagccactgttggatttgagagcctg
gaggagtgttatatggcaaagatacttgttgctgaaggtaccagggatgttcccattgga
gcgatcatctgtatcacagttggcaagcctgaagatattgaggcttttaaaaattataca
ttggattcctcgccagcacctaccccacaggcggccccagcaccaacccctgctgccact
gcttcgccacctataccttctgctcaggctcctggtagctcatatccccctcacatgcag
gtacttcttcctgccctctctcccaccatgaccatgggcacagttcagagatgggaaaaa
aaagtgggtgagaagctaagtgaaggagacttactggcagagatagagactgacaaagcc
actataggttttgaagtacaggaagaaggttatctggcaaaaatcctggtccctgaaggc
acaagagatgtccctctaggaaccccactctgtatcattgtagaaaaagaggcagatata
tcagcatttgctgactataggccaactgaagtaacagatttaaaaccacaagcaccacca
cctaccccacccccggtggccactgttcctccaactcctcagcctttagctcctacacct
tcagcaccctgccctgctactcctgctggaccaaagggaagggtgtttgttagccctctt
gcaaagaagttggcagtagagaaagggattgatcttacacaagtaaaagggacaggacca
gatggtagaatcaccaagaaggatattgactcttttgtgcctagtaaagctgctcctgct
ccagcagctgttgtgcctcccacaggtcctggaatggcaccagttcctacaggtgtcttc
acagatatcccaattagcaacattcgtcgggttattgcacagcgattaatgcaatcaaag
caaaccatacctcattattacctttctatagatgtaaatatgggagaagttttgttggta
cggaaagaacttaataagattttagaagggagaagcaaaatttctgtcaatgacttcatc
ataaaagcttcagctttggcatgtttaaaagttcccgaagcaaattcttcttggatggac
acagttataagacaaaatcatgttgttgatgtcagtgttgcagtcagtactcctgcagga
ctcatcacacctattgtgtttaatgcacatataaaaggactggaaaccattgccaatgat
gttgtttctttagcagccaaagcaagagagggtaaactacagccacacgaattccagggt
ggcacttttacgatctccaatttaggaatgtttggaattaagaatttctctgctattatt
aacccacctcaagcatgtattttggcaattggtgcttcagaggataaactggttccagca
gataatgaaaaagggtttgatgtggctagcatgatgtctgttacactcagttgtgatcac
cgggtggtggatggagcagttggagcccagtggcttgctgagtttagaaagtaccttgaa
aaacctgtcaccatgttgttgtaa

DBGET integrated database retrieval system