KEGG   Macaca mulatta (rhesus monkey): 710959Help
Entry
710959            CDS       T01028                                 

Gene name
TMSB4X
Definition
thymosin beta 4, X-linked
Orthology
K05764  
thymosin, beta 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    710959 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagagacgcaagagaaaaatccactgccttccaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system