KEGG   Macaca mulatta (rhesus monkey): 711029Help
Entry
711029            CDS       T01028                                 

Gene name
PDIA3, GRP58
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    711029 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    711029 (PDIA3)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     711029 (PDIA3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   711029 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   711029 (PDIA3)
  Exosomal proteins of bladder cancer cells
   711029 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 505 aa AA seqDB search
MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFDDLFSEAHSEFLKAASNLRD
NYRFAHTNVKSLVNEYDDNGEGIILFRPSHLTNKFEDKTVAYTEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGHKLNFA
VASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPVIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgccttcgccgccttgcgctattcccgggcgtggcgctgcttctcgccgcggcccgc
ctcgccgctgcctccgatgtgttagaactcacggacgacaacttcgagagtcgcgtctcc
gacacgggctctgcgggcctcatgctcgtggagttcttcgccccctggtgtggacactgc
aagagacttgctcctgaatatgaagctgcagctaccagattaaaaggaatagtcccatta
gcaaaggttgattgcactgccaacactaacacctgtaataaatacggcgtcagtggatat
ccaaccctgaagatatttagagatggtgaagaagcaggtgcttatgatggacctaggact
gctgatggaattgtcagccacctgaagaagcaggcaggaccagcttcagtgcctctcagg
actgaggaagaatttaagaaattcattagtgataaagatgcgtctgtagtaggttttttc
gatgatttattcagtgaagctcactctgagttcctaaaagcagccagcaacttgagggat
aactaccgatttgcacatacgaatgttaagtctctggtgaacgagtatgatgataatgga
gagggtatcatcttatttcgtccttcacatctgactaacaagtttgaggacaagactgtg
gcatatacagagcaaaaaatgaccagtggcaaaattaaaaagttcatccaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttgatacagggcaaggactta
cttattgcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagggtaatgatggtggcaaagaaatttctggatgctgggcacaaactcaactttgct
gtagctagccgcaaaacctttagccatgaactttctgattttggcttggagagcactgct
ggagagattcctgttgttgctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgtgatgggaaggctctggagaggtttctgcaggattactttgatggcaat
ctgaagagatacctgaagtctgaacctatcccagagagcaatgatgggcctgtaaaggta
gtggtagcagagaattttgatgaaatagtgaataatgaaaataaagatgtactgattgaa
ttttatgctccttggtgtggtcactgtaagaatctggagcccaagtataaagaacttgga
gagaagctcagcaaagacccaaatatcgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatatacttctctccagccaacaag
aagctaaatccaaagaaatatgaaggtggccgtgaattaagtgattttattagctatcta
caacgagaagctacaaacccccctgtaattcaagaagaaaaacccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system