KEGG   Macaca mulatta (rhesus monkey): 711033Help
Entry
711033            CDS       T01028                                 

Gene name
ARG2
Definition
arginase, type II (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    711033 (ARG2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    711033 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    711033 (ARG2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     711033 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 354 aa AA seqDB search
MSLRGSLSRLLQKRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYGQLPTPSSPDESENQARVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaaggggcagcctctcgcgtctcctccagaagcgagtgcattccatcctgaag
aaatccgtccactctgtggctgtgataggagccccgttctcacaagggcagaaaagaaaa
ggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctccagt
ctgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagatgat
ctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactggct
gaggtggttagcagagctgtgtcagatggctacagctgtgtcacactgggaggagaccac
agcctggcaattggtaccattagcggccatgcccgacactgcccagacctttgcgttgtc
tgggttgatgcccatgctgacatcaacacaccccttaccacttcatcaggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtaccacaactaccagga
ttttcctggatcaaaccttgtatctcttccccaagtattgtgtatattggtctaagagac
gtggacccccctgaacattttattttaaagaactatgatatccagtatttttccatgaga
gacattgatcgacttggtatccagaaggtcatggaacaaacatttgatctgctgattggc
aagagacaaagaccaatccatctgagttttgatattgatgcatttgaccctacactggct
ccagccacaggaactcctgttgtagggggactaacctatcgagaaggcatgtatattgct
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatcctcag
ttggccacctcagaggaagaggcgaagactacagctaacctggcagtggatgtgattgct
tcaagttttggtcagacaagagaaggagggcatattgtctatggccaacttcctactccc
agttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system