KEGG   Macaca mulatta (rhesus monkey): 711033Help
Entry
711033            CDS       T01028                                 

Gene name
ARG2
Definition
(RefSeq) arginase, type II (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    711033 (ARG2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    711033 (ARG2)
   00330 Arginine and proline metabolism
    711033 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    711033 (ARG2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     711033 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 354 aa AA seqDB search
MSLRGSLSRLLQKRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYGQLPTPSSPDESENQARVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaaggggcagcctctcgcgtctcctccagaagcgagtgcattccatcctgaag
aaatccgtccactctgtggctgtgataggagccccgttctcacaagggcagaaaagaaaa
ggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctccagt
ctgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagatgat
ctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactggct
gaggtggttagcagagctgtgtcagatggctacagctgtgtcacactgggaggagaccac
agcctggcaattggtaccattagcggccatgcccgacactgcccagacctttgcgttgtc
tgggttgatgcccatgctgacatcaacacaccccttaccacttcatcaggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtaccacaactaccagga
ttttcctggatcaaaccttgtatctcttccccaagtattgtgtatattggtctaagagac
gtggacccccctgaacattttattttaaagaactatgatatccagtatttttccatgaga
gacattgatcgacttggtatccagaaggtcatggaacaaacatttgatctgctgattggc
aagagacaaagaccaatccatctgagttttgatattgatgcatttgaccctacactggct
ccagccacaggaactcctgttgtagggggactaacctatcgagaaggcatgtatattgct
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatcctcag
ttggccacctcagaggaagaggcgaagactacagctaacctggcagtggatgtgattgct
tcaagttttggtcagacaagagaaggagggcatattgtctatggccaacttcctactccc
agttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system