KEGG   Macaca mulatta (rhesus monkey): 711033Help
Entry
711033            CDS       T01028                                 

Gene name
ARG2
Definition
(RefSeq) arginase 2
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00220  Arginine biosynthesis
mcc00330  Arginine and proline metabolism
mcc01100  Metabolic pathways
mcc01230  Biosynthesis of amino acids
mcc05146  Amoebiasis
Module
mcc_M00029  Urea cycle
mcc_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    711033 (ARG2)
   00330 Arginine and proline metabolism
    711033 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    711033 (ARG2)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     711033 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 711033
NCBI-ProteinID: NP_001248182
Ensembl: ENSMMUG00000015865
UniProt: F7C244
Position
7
AA seq 354 aa AA seqDB search
MSLRGSLSRLLQKRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSS
LGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDH
SLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQ
LATSEEEAKTTANLAVDVIASSFGQTREGGHIVYGQLPTPSSPDESENQARVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctaaggggcagcctctcgcgtctcctccagaagcgagtgcattccatcctgaag
aaatccgtccactctgtggctgtgataggagccccgttctcacaagggcagaaaagaaaa
ggagtggagcatggtcccgctgccataagagaagctggcttgatgaaaaggctctccagt
ctgggctgccacctaaaagactttggagatttgagttttactccagtccccaaagatgat
ctctacaacaacctgatagtgaatccacgctcagtgggtcttgccaaccaggaactggct
gaggtggttagcagagctgtgtcagatggctacagctgtgtcacactgggaggagaccac
agcctggcaattggtaccattagcggccatgcccgacactgcccagacctttgcgttgtc
tgggttgatgcccatgctgacatcaacacaccccttaccacttcatcaggaaatctccat
ggacagccagtttcatttctcctcagagaactacaggacaaggtaccacaactaccagga
ttttcctggatcaaaccttgtatctcttccccaagtattgtgtatattggtctaagagac
gtggacccccctgaacattttattttaaagaactatgatatccagtatttttccatgaga
gacattgatcgacttggtatccagaaggtcatggaacaaacatttgatctgctgattggc
aagagacaaagaccaatccatctgagttttgatattgatgcatttgaccctacactggct
ccagccacaggaactcctgttgtagggggactaacctatcgagaaggcatgtatattgct
gaggaaatacacaatacagggttgctgtcagcactggatcttgttgaagtcaatcctcag
ttggccacctcagaggaagaggcgaagactacagctaacctggcagtggatgtgattgct
tcaagttttggtcagacaagagaaggagggcatattgtctatggccaacttcctactccc
agttcaccagatgaatcagaaaatcaagcacgtgtgagaatttag

DBGET integrated database retrieval system