KEGG   Macaca mulatta (rhesus monkey): 711040Help
Entry
711040            CDS       T01028                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1 (Drosophila) (EC:2.1.1.43)
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    711040 (SUV39H1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     711040 (SUV39H1)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     711040 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    711040 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPTGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgcagcgtgtgttgcaagtcttcttggaatcagctgcag
gacctgtgccgcctggccaagctctcctgccctgccctcggtatctctaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattacaagaagatccgcgaacaggaatattac
ctggtgaaatggcgcggatatccagactcagagagcacctgggagccacggcagaatctc
aagtgtgtgcgtattctcaagcagttccacaaggacttagagagggagctgctccggcgg
caccaccggtcaaagaccccccggcacctggacccaagcttggccaactacctggtgcag
aaggccaagcagaggcgggcgctccgccgctgggagcaggagctcaatgccaagcgcagc
catctgggacgcatcactgtagagaatgaggtggacctggacggccccccgcgggccttc
gtgtacatcaatgagtaccgtgttggtgagggcatcaccctcaaccaggtggctgtgggc
tgcgagtgccaggactgtctgtgggcacccactggaggctgctgcccgggggcatcactg
cacaagtttgcctacaatgaccagggccaggtgcggcttcgagccgggctgcccatctac
gagtgcaactcccgctgccgctgtggctatgactgcccgaatcgcgtggtacagaaaggc
atccgatatgacctctgcatcttccgcacggatgatgggcgtggctggggcgtccgcacc
ctggagaagattcgcaagaacagcttcgtcatggagtacgtgggagagatcattacctca
gaggaggcggagcggcggggccagatctacgaccgccagggtgccacctacctctttgac
ctggactacgtggaggacgtgtacaccgtggatgccgcctactatggcaacatctcccac
tttgtcaaccacagttgtgaccccaacctgcaggtgtacaacgtcttcatagacaacctt
gacgagcggctgccccgcatcgctttctttgccacaagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagcacccgcatggac
tccaactttggcctggctgggctccctggctcccctaagaagcgggtccgtattgagtgc
aagtgtgggactgagtcctgccgcaaatacctcttctag

DBGET integrated database retrieval system