KEGG   Macaca mulatta (rhesus monkey): 711108Help
Entry
711108            CDS       T01028                                 

Definition
3-hydroxybutyrate dehydrogenase type 2-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mcc00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mcc00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 245 aa AA seqDB search
MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDQFANEVERVDVLFNVAGTLVHGSXLDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSIKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaagtcatcatcctgacagccgctgctcaggggattggccaa
gcagctgccttagcttttgcaagagaaggtgccaaagtcatagccacagacattaatgag
tccaaacttcaggaactggaaaagtacccgggcattcaaactcgtgtccttgatgtcaca
aagaagaaacaaattgatcagtttgccaatgaagttgagagagttgatgttctctttaat
gttgctggaactttggtacatggaagtnnnctggattgtgaggagaaagactgggacttc
tcgatgaatctcaatgtgcgcagcatgtacctgatgatcaaggcattccttcctaaaatg
cttgctcagaaatctggcaatattatcaacatgtcttctgtggcttccagcatcaaagga
gttgtgaacagatgtgtgtacagcacaaccaaggcagctgtgattggcctcacaaaatct
gtggctgcagatttcatccagcagggcatcaggtgcaactgtgtgtgcccaggaacggtt
gataccccatctctacaagaaagaatacaagccagaggaaatcctgaagaggcacggaat
gatttcctgaagagacaaaagacgggaagatttgcaactgcagaagaaatagccatgctc
tgcgtgtatttggcttctgatgaatctgcttatgtaactggtaaccctgtcatcattgat
ggaggctggagcttgtga

DBGET integrated database retrieval system