KEGG   Macaca mulatta (rhesus monkey): 711108Help
Entry
711108            CDS       T01028                                 

Definition
3-hydroxybutyrate dehydrogenase type 2-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    711108
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    711108
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     711108
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 245 aa AA seqDB search
MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVT
KKKQIDQFANEVERVDVLFNVAGTLVHGSXLDCEEKDWDFSMNLNVRSMYLMIKAFLPKM
LAQKSGNIINMSSVASSIKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV
DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIID
GGWSL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgacttgatgggaaagtcatcatcctgacagccgctgctcaggggattggccaa
gcagctgccttagcttttgcaagagaaggtgccaaagtcatagccacagacattaatgag
tccaaacttcaggaactggaaaagtacccgggcattcaaactcgtgtccttgatgtcaca
aagaagaaacaaattgatcagtttgccaatgaagttgagagagttgatgttctctttaat
gttgctggaactttggtacatggaagtnnnctggattgtgaggagaaagactgggacttc
tcgatgaatctcaatgtgcgcagcatgtacctgatgatcaaggcattccttcctaaaatg
cttgctcagaaatctggcaatattatcaacatgtcttctgtggcttccagcatcaaagga
gttgtgaacagatgtgtgtacagcacaaccaaggcagctgtgattggcctcacaaaatct
gtggctgcagatttcatccagcagggcatcaggtgcaactgtgtgtgcccaggaacggtt
gataccccatctctacaagaaagaatacaagccagaggaaatcctgaagaggcacggaat
gatttcctgaagagacaaaagacgggaagatttgcaactgcagaagaaatagccatgctc
tgcgtgtatttggcttctgatgaatctgcttatgtaactggtaaccctgtcatcattgat
ggaggctggagcttgtga

DBGET integrated database retrieval system