KEGG   Macaca mulatta (rhesus monkey): 711115Help
Entry
711115            CDS       T01028                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04024  cAMP signaling pathway
mcc04068  FoxO signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04137  Mitophagy - animal
mcc04140  Autophagy - animal
mcc04141  Protein processing in endoplasmic reticulum
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04310  Wnt signaling pathway
mcc04380  Osteoclast differentiation
mcc04510  Focal adhesion
mcc04530  Tight junction
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04622  RIG-I-like receptor signaling pathway
mcc04625  C-type lectin receptor signaling pathway
mcc04657  IL-17 signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04664  Fc epsilon RI signaling pathway
mcc04668  TNF signaling pathway
mcc04722  Neurotrophin signaling pathway
mcc04723  Retrograde endocannabinoid signaling
mcc04728  Dopaminergic synapse
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04910  Insulin signaling pathway
mcc04912  GnRH signaling pathway
mcc04914  Progesterone-mediated oocyte maturation
mcc04917  Prolactin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04926  Relaxin signaling pathway
mcc04930  Type II diabetes mellitus
mcc04931  Insulin resistance
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc04933  AGE-RAGE signaling pathway in diabetic complications
mcc05132  Salmonella infection
mcc05133  Pertussis
mcc05142  Chagas disease (American trypanosomiasis)
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05164  Influenza A
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex infection
mcc05169  Epstein-Barr virus infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
mcc05418  Fluid shear stress and atherosclerosis
Module
mcc_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    711115 (MAPK8)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    711115 (MAPK8)
   04010 MAPK signaling pathway
    711115 (MAPK8)
   04012 ErbB signaling pathway
    711115 (MAPK8)
   04310 Wnt signaling pathway
    711115 (MAPK8)
   04668 TNF signaling pathway
    711115 (MAPK8)
   04068 FoxO signaling pathway
    711115 (MAPK8)
   04071 Sphingolipid signaling pathway
    711115 (MAPK8)
   04024 cAMP signaling pathway
    711115 (MAPK8)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    711115 (MAPK8)
   04137 Mitophagy - animal
    711115 (MAPK8)
  Cell growth and death
   04210 Apoptosis
    711115 (MAPK8)
   04215 Apoptosis - multiple species
    711115 (MAPK8)
   04217 Necroptosis
    711115 (MAPK8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    711115 (MAPK8)
   04530 Tight junction
    711115 (MAPK8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    711115 (MAPK8)
   04621 NOD-like receptor signaling pathway
    711115 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    711115 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    711115 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    711115 (MAPK8)
   04659 Th17 cell differentiation
    711115 (MAPK8)
   04657 IL-17 signaling pathway
    711115 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    711115 (MAPK8)
  Endocrine system
   04910 Insulin signaling pathway
    711115 (MAPK8)
   04920 Adipocytokine signaling pathway
    711115 (MAPK8)
   04912 GnRH signaling pathway
    711115 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    711115 (MAPK8)
   04917 Prolactin signaling pathway
    711115 (MAPK8)
   04926 Relaxin signaling pathway
    711115 (MAPK8)
  Nervous system
   04728 Dopaminergic synapse
    711115 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    711115 (MAPK8)
   04722 Neurotrophin signaling pathway
    711115 (MAPK8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    711115 (MAPK8)
  Development
   04380 Osteoclast differentiation
    711115 (MAPK8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    711115 (MAPK8)
   05231 Choline metabolism in cancer
    711115 (MAPK8)
   05210 Colorectal cancer
    711115 (MAPK8)
   05212 Pancreatic cancer
    711115 (MAPK8)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    711115 (MAPK8)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    711115 (MAPK8)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    711115 (MAPK8)
   04931 Insulin resistance
    711115 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    711115 (MAPK8)
  Infectious diseases
   05132 Salmonella infection
    711115 (MAPK8)
   05133 Pertussis
    711115 (MAPK8)
   05152 Tuberculosis
    711115 (MAPK8)
   05164 Influenza A
    711115 (MAPK8)
   05161 Hepatitis B
    711115 (MAPK8)
   05160 Hepatitis C
    711115 (MAPK8)
   05168 Herpes simplex infection
    711115 (MAPK8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    711115 (MAPK8)
   05169 Epstein-Barr virus infection
    711115 (MAPK8)
   05145 Toxoplasmosis
    711115 (MAPK8)
   05142 Chagas disease (American trypanosomiasis)
    711115 (MAPK8)
  Drug resistance
   01522 Endocrine resistance
    711115 (MAPK8)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     711115 (MAPK8)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   711115 (MAPK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH FTA2 DUF530
Motif
Other DBs
NCBI-GeneID: 711115
NCBI-ProteinID: XP_015002462
Ensembl: ENSMMUG00000004060
UniProt: H9EQK5
Position
9
AA seq 427 aa AA seqDB search
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggctcaggagcgcaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacaagtttt
atgatgacgccttacgtagtgactcgctactacagagcacccgaggtcatccttggcatg
ggctacaaggaaaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactgcaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagcttcgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

DBGET integrated database retrieval system