KEGG   Macaca mulatta (rhesus monkey): 711283Help
Entry
711283            CDS       T01028                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mcc00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 198 aa AA seqDB search
MFGLLDNVTVLIGIAYEGKAIAGVINQPYYNYENKEKQQLREHRNEAKAGPDAVLGRTIW
GVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVTAMNPDAVLRVGGAGNKIIQLIE
GKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRN
YDYYASRVPESIKNALVP
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgttcggtcttcttgacaatgtaacagttcttattggaattgcttatgaaggaaaagcc
atagcaggagttattaaccagccatattacaactatgagaacaaggaaaagcagcagtta
agggaacacaggaatgaagcaaaggcaggaccagatgctgtgttggggaggacaatctgg
ggagttttaggtttaggtgcctttgggtttcagctgaaagaagtccctgctgggaaacac
attatcacaactactcgatcccatagcaacaagttggttactgactgtgttactgctatg
aaccccgatgctgtgttgcgagtaggcggagcaggaaataagattattcagctgattgaa
ggcaaagcctctgcttatgtatttgcaagtcctggttgtaagaagtgggatacttgtgct
ccagaagttattttacatgctgtgggaggcaagttaactgatatccatgggaatgttctt
caataccacaaggatgtgaagcatatgaactctgcaggagtcctggccacactgaggaat
tatgactactatgcaagccgagttccagaatctattaaaaatgcacttgttccttaa

DBGET integrated database retrieval system