KEGG   Macaca mulatta (rhesus monkey): 711350Help
Entry
711350            CDS       T01028                                 

Definition
ras-specific guanine nucleotide-releasing factor 2-like
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    711350
   04010 MAPK signaling pathway
    711350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1086 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGPGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTVVF
EENSKVTVPHMIKLRRPVSTDIGQSGIMWTQSVAAGELCHVAALIIHGLGPADGEDLKVL
DEHYFSMSLKVQSVLESAPADRAGVESSPAADTTELSPCRSPSTPRHLRYRQPGGQTADN
AHCSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQ
DFELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTD
CMKAECFQSLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFN
DMSNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKT
WAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNF
TEEGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVTQYLLDKDLIIDEDTLYELSLKI
EPRLPA
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggctttcctggcgcgc
aaggagggcaccaagcgcggcttcctgagtaagaagacggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagctgc
cgcccggcgggcatgtacctcctggagggctgcagctgcgaacgaacgcccgcgccaccc
agggccggcgccgggccaggaggcgtccgggacgcgctggacaagcagtattactttact
gttctttttggccatgaaggtcagaagccactggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtattaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcaacttgaagatcaagacacagaaatcgaaaggcttaaatca
gagattattgctcttaataaaaccaaagaacgaatgcgaccttaccaaagcaaccaagaa
gatgaagatccagacatcaagaagattaaaaaggttcagagcttcatgcgaggatggttg
tgcagaaggaaatggaagaccattgtgcaggattacatttgctctccccatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggtggaggcagagtcagagtacgttcac
cagctctacatcctggtcaacggctttctccggcccctgcgtatggccgccagctccaag
aagccccccatcagccacgatgacgtcagcagtatttttctcaacagtgaaacaatcatg
tttcttcatgaaatatttcatcaaggactaaaggcaaggatagcaaactggcccacttta
attttagctgatctgtttgatattttgctccccatgctgaacatttatcaagaatttgta
cgtaatcaccaatacagcctgcaagttctcgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaatccagcctgtgaggggaggatgctggagacattc
ttgacctatcccatgtttcagatccccagatatatcatcacactccatgagctcctcgct
cacacaccccatgagcatgtggaaaggaaaagcctggagtttgccaaatcaaagctagag
gaactgtccagagtaatgcacgatgaagtcagcgacactgaaaacataaggaaaaacctt
gccatcgaaagaatgatcgtggagggctgtgacatcttgctggacaccagccaaacgttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaagcttagtaaagtt
cgcctgggttcgttgtctttgaaaaaggaaggagagagacaatgcttcttatttacaaaa
cactttttaatatgcacaagaagttcaggagggaagctgcatctgctcaagacaggtggg
gttctgtctctaatagactgcacattgattgaggagccagatgcaagcgatgatgactct
aaaggttctgggcaagtgtttgggcacctggattttaaaatagtggtggagcctcccgac
gctgccgccttcactgttgtcttgttagcgccctcacgccaggagaaagctgcctggatg
agtgacatcagtcagtgtgtggacaatatacgatgtaatggtttaatgactgtagtgttt
gaagagaattccaaagtcactgtgccacatatgattaaacttcgaagacctgtcagtaca
gatattggacagagtgggatcatgtggacacagtcagtggctgctggagagctttgtcat
gtggcagcactgatcattcatggcctggggccagcagatggagaggacctgaaagtcctt
gatgaacactacttcagcatgagtctgaaagttcagtcagtcctagagtctgcaccggcg
gaccgagcaggagtggaaagctcccctgcagcggacaccacagaactttcaccttgcaga
tccccctcaactccccggcacctccgctatcgccagcctggaggacagacggcggacaat
gcccactgctctgtttcaccggcttctgcttttgcaatagccacagctgcagcaggacat
gggagtccaccaggctttaacaacaccgagcgaacatgtgataaagagtttatcatacgg
agaacggctaccaaccgagtactgaacgtcctccgtcactgggtctcaaagcacgcacag
gattttgaactcaacaatgaactaaagatgaatgtcctaaatttactagaagaagttctg
cgagacccagaccttcttccccaagaaaggaaagccaccgcaaatatcctcagggccctc
tcacaagatgaccaagatgacatccacctaaaattagaggatataattcaaatgactgac
tgcatgaaggccgaatgctttcagtccttgtcggccatggagctggcggaacagatcacc
ctcctggaccatgtcattttcagaagcattccctacgaggagtttcttgggcaggggtgg
atgaagctggataaaaacgaaagaactccttacattatgaaaaccagccaacacttcaac
gacatgagtaacctggtggcctcccagataatgaattatgctgatgtcagctcccgtgcc
aacgccattgagaaatgggtggcggtggcggacatctgccgatgcctgcacaattacaac
ggcgtgctggaaatcacctcggccttgaacagaagtgccatctacaggctgaagaaaacc
tgggccaaggtctctaagcagacaaaagctctaatggacaaacttcaaaagactgtttcc
tctgaaggaagatttaaaaatcttagagaaacccttaaaaattgtaaccctcctgcagtt
ccttaccttgggatgtacttgacagacctggcatttattgaagaaggaacaccaaacttc
actgaggaaggccttgtcaatttctccaaaatgagaatgatatcacacatcatcagagag
atacgccagttccagcagacttcctacagaatagatcatcagccaaaggtcacacagtac
ttgcttgacaaagaccttatcatagatgaagatacgctatatgagctgtcactaaaaatt
gaacctcgactccctgcttga

DBGET integrated database retrieval system