KEGG   Macaca mulatta (rhesus monkey): 711350Help
Entry
711350            CDS       T01028                                 

Gene name
RASGRF2
Definition
(RefSeq) Ras protein specific guanine nucleotide releasing factor 2
  KO
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    711350 (RASGRF2)
   04010 MAPK signaling pathway
    711350 (RASGRF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1237 aa AA seqDB search
MQKSVRYNEGHALYLAFLARKEGTKRGFLSKKTAEASRWHEKWFALYQNVLFYFEGEQSC
RPAGMYLLEGCSCERTPAPPRAGAGPGGVRDALDKQYYFTVLFGHEGQKPLELRCEEEQD
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKS
EIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIM
FLHEIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIDCTLIEEPDASDDDS
KGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTVVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNNRGEHLVDGKSPR
LCRKFSSPPPLAVSRTSSPVRARKLSLTSPSNSKIGALDLTTSSSPTTMTQSPAASPPPH
TGQIPLDLSRGLSSPEQSPGSVEENVDNPRVDLCNKLKRSIQKAVLESAPADRAGVESSP
AADTTELSPCRSPSTPRHLRYRQPGGQTADNAHCSVSPASAFAIATAAAGHGSPPGFNNT
ERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQE
RKATANILRALSQDDQDDIHLKLEDIIQMTDCMKAECFQSLSAMELAEQITLLDHVIFRS
IPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDMSNLVASQIMNYADVSSRANAIEKWVAV
ADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLR
ETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSY
RIDHQPKVTQYLLDKDLIIDEDTLYELSLKIEPRLPA
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggctttcctggcgcgc
aaggagggcaccaagcgcggcttcctgagtaagaagacggccgaggcgagccgctggcac
gagaagtggttcgccctctaccagaatgtgctcttctacttcgagggcgagcagagctgc
cgcccggcgggcatgtacctcctggagggctgcagctgcgaacgaacgcccgcgccaccc
agggccggcgccgggccaggaggcgtccgggacgcgctggacaagcagtattactttact
gttctttttggccatgaaggtcagaagccactggagctgcgctgtgaggaggagcaggat
ggtaaagagtggatggaggccattcaccaagccagttatgcagacattttgattgagagg
gaagtattaatgcagaagtacattcatctagttcagatcgtagagacagaaaaaattgca
gctaaccaactccgacatcaacttgaagatcaagacacagaaatcgaaaggcttaaatca
gagattattgctcttaataaaaccaaagaacgaatgcgaccttaccaaagcaaccaagaa
gatgaagatccagacatcaagaagattaaaaaggttcagagcttcatgcgaggatggttg
tgcagaaggaaatggaagaccattgtgcaggattacatttgctctccccatgctgaaagt
atgaggaagagaaaccagattgtgttcaccatggtggaggcagagtcagagtacgttcac
cagctctacatcctggtcaacggctttctccggcccctgcgtatggccgccagctccaag
aagccccccatcagccacgatgacgtcagcagtatttttctcaacagtgaaacaatcatg
tttcttcatgaaatatttcatcaaggactaaaggcaaggatagcaaactggcccacttta
attttagctgatctgtttgatattttgctccccatgctgaacatttatcaagaatttgta
cgtaatcaccaatacagcctgcaagttctcgccaattgtaagcaaaacagagattttgac
aaactcttaaaacagtatgaagccaatccagcctgtgaggggaggatgctggagacattc
ttgacctatcccatgtttcagatccccagatatatcatcacactccatgagctcctcgct
cacacaccccatgagcatgtggaaaggaaaagcctggagtttgccaaatcaaagctagag
gaactgtccagagtaatgcacgatgaagtcagcgacactgaaaacataaggaaaaacctt
gccatcgaaagaatgatcgtggagggctgtgacatcttgctggacaccagccaaacgttc
atccgccaaggttctcttattcaagtaccttccgttgagagggggaagcttagtaaagtt
cgcctgggttcgttgtctttgaaaaaggaaggagagagacaatgcttcttatttacaaaa
cactttttaatatgcacaagaagttcaggagggaagctgcatctgctcaagacaggtggg
gttctgtctctaatagactgcacattgattgaggagccagatgcaagcgatgatgactct
aaaggttctgggcaagtgtttgggcacctggattttaaaatagtggtggagcctcccgac
gctgccgccttcactgttgtcttgttagcgccctcacgccaggagaaagctgcctggatg
agtgacatcagtcagtgtgtggacaatatacgatgtaatggtttaatgactgtagtgttt
gaagagaattccaaagtcactgtgccacatatgattaagtctgatgcccgccttcataaa
gacgacactgacatttgcttcagtaaaacactcaactcctgcaaagtgccccagatccgt
tatgccagcgtggagcgcctcttggaacgactgacagacttgcggtttcttagtatcgat
ttcctcaacacctttctgcacacctatcgtattttcactactgccgctgtggtgctgggg
aaactctctgacatatacaagaggcctttcacctccatccccgtcaggtcattggaattg
ttttttgctaccagccagaacaacagaggtgaacatttggtggatggaaaatccccacgt
ctgtgtcgcaaattctcttccccaccaccactggctgtgtcgagaacatcttccccagtg
agggccagaaagctgtctttgacttctccctcgaactcaaagataggagcattggacctg
acgacttccagcagtcccaccaccatgacccagagccctgctgcctctccaccgccacac
actggtcaaataccactggatctcagcagaggcctctcctctccagagcaaagcccggga
tcagtagaagagaatgtcgataacccgcgcgtggatctgtgtaacaagctaaaacgaagt
atccaaaaagcagtcctagagtctgcaccggcggaccgagcaggagtggaaagctcccct
gcagcggacaccacagaactttcaccttgcagatccccctcaactccccggcacctccgc
tatcgccagcctggaggacagacggcggacaatgcccactgctctgtttcaccggcttct
gcttttgcaatagccacagctgcagcaggacatgggagtccaccaggctttaacaacacc
gagcgaacatgtgataaagagtttatcatacggagaacggctaccaaccgagtactgaac
gtcctccgtcactgggtctcaaagcacgcacaggattttgaactcaacaatgaactaaag
atgaatgtcctaaatttactagaagaagttctgcgagacccagaccttcttccccaagaa
aggaaagccaccgcaaatatcctcagggccctctcacaagatgaccaagatgacatccac
ctaaaattagaggatataattcaaatgactgactgcatgaaggccgaatgctttcagtcc
ttgtcggccatggagctggcggaacagatcaccctcctggaccatgtcattttcagaagc
attccctacgaggagtttcttgggcaggggtggatgaagctggataaaaacgaaagaact
ccttacattatgaaaaccagccaacacttcaacgacatgagtaacctggtggcctcccag
ataatgaattatgctgatgtcagctcccgtgccaacgccattgagaaatgggtggcggtg
gcggacatctgccgatgcctgcacaattacaacggcgtgctggaaatcacctcggccttg
aacagaagtgccatctacaggctgaagaaaacctgggccaaggtctctaagcagacaaaa
gctctaatggacaaacttcaaaagactgtttcctctgaaggaagatttaaaaatcttaga
gaaacccttaaaaattgtaaccctcctgcagttccttaccttgggatgtacttgacagac
ctggcatttattgaagaaggaacaccaaacttcactgaggaaggccttgtcaatttctcc
aaaatgagaatgatatcacacatcatcagagagatacgccagttccagcagacttcctac
agaatagatcatcagccaaaggtcacacagtacttgcttgacaaagaccttatcatagat
gaagatacgctatatgagctgtcactaaaaattgaacctcgactccctgcttga

DBGET integrated database retrieval system