KEGG   Macaca mulatta (rhesus monkey): 711563Help
Entry
711563            CDS       T01028                                 

Gene name
CLTC
Definition
(RefSeq) clathrin, heavy chain (Hc)
  KO
K04646  
clathrin heavy chain
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    711563 (CLTC)
   04142 Lysosome
    711563 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    711563 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    711563 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    711563 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    711563 (CLTC)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   711563 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 1682 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDAIKEKVDKL
DASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGY
SM
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaacctgggtatc
aacccagcaaacattggcttcagtaccctgactatggagtctgacaaattcatctgcatt
agagaaaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccagctagcaaagtaatt
gcactgaaagctgggaaaactcttcagatttttaacattgaaatgaaaagtaaaatgaag
gctcatactatgactgatgatgtcaccttttggaaatggatctctttgaatacggttgct
cttgttaccgataatgcagtttatcactggagtatggaaggagagtctcagccagtgaaa
atgtttgatcgccattctagccttgcagggtgccagattatcaattaccgtacagatgca
aaacaaaagtggttacttctgactggtatatctgcacagcaaaatcgtgtggtgggagct
atgcagctatattctgtagataggaaagtgtctcagcccattgaaggacatgcagctagc
ttcgcacagtttaagatggaaggaaatgcagaagaatcaacattattttgttttgcagta
cggggccaagctggagggaagttacatattattgaagttggcacaccacctacagggaac
cagccctttccaaagaaggcagtggatgttttctttcctccagaagcacaaaatgatttt
cctgttgcaatgcagatcagtgaaaagcatgatgtggtattcttgataaccaagtatggt
tatatccacctctatgatcttgagactggtacctgcatctacatgaatagaatcagtgga
gaaacgatttttgttactgcacctcatgaagccacagctggaataattggagtaaacaga
aagggacaagttctgtcagtgtgtgtggaagaagaaaacataattccttacatcaccaat
gttctacaaaatcctgatttggctctgagaatggctgtacgtaacaacttagccggtgct
gaagaactctttgcccggaaatttaatgctctttttgcccagggaaattactcagaggca
gcaaaggtggctgctaatgcaccaaagggtattcttcgtactccagacactatccgtcgg
ttccagagtgtcccagcccagccaggtcaaacttctcctctacttcaatactttggtatc
cttttggaccagggacagctcaacaaatacgaatccttagagctttgtaggcctgtactt
cagcaagggcgaaaacagcttttggagaaatggttaaaagaagataagctggaatgttct
gaagaactgggtgatcttgtgaaatctgtggaccctacattggcacttagtgtgtaccta
agggctaacgtcccaaataaagtcattcagtgctttgcagaaacaggtcaagtccagaag
attgttttatatgctaaaaaagttggatacactccagattggatatttctgctgagaaat
gtaatgcgaatcagtccagatcagggacagcagtttgcccaaatgttagttcaagatgaa
gagcctcttgctgacatcacacagattgtagatgtctttatggaatacaatctaattcag
caatgtactgcattcttgcttgatgctctgaagaataatcgcccatctgaaggtccttta
cagacgcggttacttgagatgaaccttatgcatgcgcctcaagttgcagatgctattcta
ggcaatcagatgttcacacattatgaccgggctcacattgctcaactgtgtgaaaaggct
ggcctactgcagcgtgcattagaacacttcactgatttatatgatataaaacgtgcagtg
gttcacacccatcttcttaaccctgagtggttagtcaactactttggttccttatcagta
gaagactccctagaatgtctcagagccatgctgtctgccaacattcgtcagaatctgcag
atctgtgttcaagtggcttctaaatatcatgaacaactgtcaactcagtctctgattgaa
ctttttgaatctttcaagagttttgaaggtctcttttattttctgggatccattgttaac
tttagtcaggacccagatgtgcactttaaatacattcaggcagcttgcaagactgggcaa
atcaaagaagtagaaagaatctgtagagaaagcaactgctatgatcctgagcgagtcaag
aattttcttaaggaagcgaaactaacagatcagctaccacttatcattgtatgtgatcga
tttgactttgtccatgatttggtgctctatttatatagaaataatcttcaaaagtatata
gagatatatgtacagaaggtgaatccaagtcgacttcctgtggttattggaggattactt
gatgttgactgttctgaagatgtcataaaaaacttgattcttgttgtaagaggtcaattc
tctactgatgagcttgttgctgaggttgaaaaaagaaacagattgaaactgcttctgcct
tggctagaggccagaattcatgagggctgtgaggagcctgctactcacaatgccttagcc
aaaatctacatagacagtaataacaacccggagagatttcttcgtgaaaatccctactat
gacagtcgcgttgttggaaagtattgtgagaagagagatccacatctggcctgtgttgct
tatgaacgtggccagtgtgatctggaacttattaatgtttgcaatgagaattccctcttc
aaaagtctttctcgctacctggtacgtcgaaaggatccagaattgtggggtagcgtgctg
ctggaaagcaatccttacaggagacccctaattgaccaggttgtacaaacagctttgtct
gagactcaggaccctgaagaagtgtcagtaactgtcaaggctttcatgactgcagacctt
cctaatgaactgattgaactgctggagaaaattgtccttgataactctgtattcagtgaa
cacaggaatctgcaaaacctccttatcctcaccgcaattaaagctgaccgtacacgtgtt
atggagtatattaaccgcttggataattatgatgccccagatattgccaatatcgccatc
agcaatgagctgtttgaagaagcatttgccattttccggaaatttgatgtcaatacttca
gcagttcaggtcttaattgaacatattggaaacttggatcgggcatatgagtttgctgaa
cgttgcaatgaacctgcggtctggagtcaacttgcaaaagcccagttgcagaaaggaatg
gtgaaagaagccattgattcttatatcaaagcagacgatccttcctcctacatggaagtt
gttcaggctgccaatactagtggaaactgggaagaactggtgaagtacttgcagatggcc
cgtaagaaggctcgagagtcctatgtggagacagaattgatatttgcgctggctaaaaca
aaccgccttgcagagttagaagaatttatcaatggaccaaataatgctcatatccaacaa
gttggtgaccgttgttatgatgaaaaaatgtatgatgctgctaagttgttgtacaataat
gtttccaattttggacgtttggcatctaccctggttcacctgggtgaatatcaggcagct
gttgatggggctaggaaagctaacagtactcgaacatggaaagaggtctgcttcgcctgt
gtagatgggaaagaattccgtcttgctcagatgtgtggacttcatattgttgtacacgca
gatgaattagaagaacttatcaactactatcaggatcgtggctattttgaagagctgatt
accatgttggaagcagcactgggacttgagcgagctcacatgggaatgtttactgaatta
gctattctatactctaaatttaagcctcagaaaatgagggagcacctggagctgttctgg
tctagagtgaatattcccaaggtgctaagagctgcagaacaagctcatctttgggcagaa
ctggtgtttttgtatgacaagtatgaagaatatgataatgccataattaccatgatgaat
catccaactgatgcctggaaagaagggcagttcaaagatatcattaccaaggttgccaat
gtggaactatactatagagcaatacagttctatttagaattcaagcctctgttgttaaat
gatttgctgatggtgctgtctccacggttggatcacactcgtgcagtcaattatttcagc
aaggttaaacagctaccactggtgaaaccatatttgcgttcagttcagaaccataacaac
aaatctgtgaatgaatcattaaacaacctctttattacagaagaagattatcaggctctg
cgaacatcaatagatgcttatgacaactttgacaatatctcgcttgctcagcgtttggaa
aaacatgaactcattgagttcaggagaattgctgcttatctcttcaaaggcaacaatcgc
tggaaacagagtgtagagctgtgcaagaaagacagcctttacaaggatgcaatgcagtat
gcttctgaatctaaagatactgagttggctgaagaactcctgcagtggtttttgcaggaa
gaaaaaagagagtgctttggagcttgtctgtttacctgttacgatcttttaaggccagat
gttgtcctagaaactgcatggaggcacaatatcatggattttgccatgccctatttcatc
caggtcatgaaggaatacttgacaaaggttgatgcaataaaggaaaaggtggataaatta
gatgcttcagaatcactgagaaaagaagaagaacaagctacagagacacaacccattgtt
tatggtcagccccagctgatgctgacagcaggacccagtgttgccgtccctccccaggca
ccttttggttatggttataccgcaccaccgtatggacagccacagcctggctttgggtac
agcatgtga

DBGET integrated database retrieval system