KEGG   Macaca mulatta (rhesus monkey): 711672Help
Entry
711672            CDS       T01028                                 

Gene name
MAP2K5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04540  Gap junction
mcc04722  Neurotrophin signaling pathway
mcc04921  Oxytocin signaling pathway
mcc05418  Fluid shear stress and atherosclerosis
Module
mcc_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    711672 (MAP2K5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    711672 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    711672 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    711672 (MAP2K5)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    711672 (MAP2K5)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     711672 (MAP2K5)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: STE group
  STE7 family
   711672 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PB1 Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 711672
NCBI-ProteinID: XP_014998030
Ensembl: ENSMMUG00000014482
Position
7
AA seq 472 aa AA seqDB search
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEQVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQWTDMTLGGQGIPLPSPSLQHRE
ITQERGGIQEHRNHRPQSRRQNQPQLLLNYVGLLSLLHQSPHSPRVMSTAGK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctagcccttggcccttttcctgccatggagaaccaggtgctggtaattcgc
atcaagatcccaaatagtggcgcggtggactggacagtgcactctgggccgcagttactc
ttcagggatgtactggatgtgataggccaggttctgcctgaagcaacaactacagcattt
gaatatgaagatgaagatggtgatcgaattacggtgagaagtgatgaggaaatgaaggca
atgctgtcatattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatactcgggccggaccctctcaacacagcagcccagcagtctcagattcactt
ccaagcaatagcttaaagaagtcttctgctgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgggacactcttggtcatggcaacggaggcacagtc
tacaaagcatatcatgtccccagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcattggattttatggagcattttttgtagaaaataggatttcaatatgt
acagaattcatggatgggggatctttggatgtatataggaaaatgccagaacaagtcctt
ggaagaattgcagtagcagttgttaaaggccttacttatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaggtcaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaaggatttcaggggagcagtatggaattcattccgatgtctgg
agcttaggaatctcttttatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccagttggagagttctcggagccgtttgtacatttcatcactcagtggact
gatatgaccttgggaggccaaggtattcccctgccctctccctcactccagcacagagaa
attacccaggagagaggaggaattcaggaacataggaatcatcgtcctcaaagcaggaga
caaaaccaaccgcaactccttcttaactacgttggtcttctttccctccttcaccaaagt
cctcattctcccagagtcatgtccactgctggaaaatga

DBGET integrated database retrieval system