KEGG   Macaca mulatta (rhesus monkey): 711672Help
Entry
711672            CDS       T01028                                 

Gene name
MAP2K5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5
  KO
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    711672 (MAP2K5)
 Cellular Processes
  Cellular community
   04540 Gap junction
    711672 (MAP2K5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    711672 (MAP2K5)
  Nervous system
   04722 Neurotrophin signaling pathway
    711672 (MAP2K5)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     711672 (MAP2K5)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   711672 (MAP2K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 472 aa AA seqDB search
MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTV
YKAYHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKMPEQVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTRGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQWTDMTLGGQGIPLPSPSLQHRE
ITQERGGIQEHRNHRPQSRRQNQPQLLLNYVGLLSLLHQSPHSPRVMSTAGK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctagcccttggcccttttcctgccatggagaaccaggtgctggtaattcgc
atcaagatcccaaatagtggcgcggtggactggacagtgcactctgggccgcagttactc
ttcagggatgtactggatgtgataggccaggttctgcctgaagcaacaactacagcattt
gaatatgaagatgaagatggtgatcgaattacggtgagaagtgatgaggaaatgaaggca
atgctgtcatattattattccacagtaatggaacagcaagtaaatggacagttaatagag
cctctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatactcgggccggaccctctcaacacagcagcccagcagtctcagattcactt
ccaagcaatagcttaaagaagtcttctgctgaactgaaaaaaatattagccaatggccag
atgaatgaacaagacatacggtatcgggacactcttggtcatggcaacggaggcacagtc
tacaaagcatatcatgtccccagtgggaaaatattagctgtaaaggtcatactactagat
attacactggaacttcagaagcaaattatgtctgaattggaaattctttataagtgtgat
tcatcatatatcattggattttatggagcattttttgtagaaaataggatttcaatatgt
acagaattcatggatgggggatctttggatgtatataggaaaatgccagaacaagtcctt
ggaagaattgcagtagcagttgttaaaggccttacttatttgtggagtttaaagatttta
catagagatgtgaagccctccaatatgctagtaaacacaagaggacaggtcaagctgtgt
gattttggagttagcactcagctggtgaattctatagccaagacgtatgttggaacaaat
gcttatatggcgcctgaaaggatttcaggggagcagtatggaattcattccgatgtctgg
agcttaggaatctcttttatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
cccgtccttccagttggagagttctcggagccgtttgtacatttcatcactcagtggact
gatatgaccttgggaggccaaggtattcccctgccctctccctcactccagcacagagaa
attacccaggagagaggaggaattcaggaacataggaatcatcgtcctcaaagcaggaga
caaaaccaaccgcaactccttcttaactacgttggtcttctttccctccttcaccaaagt
cctcattctcccagagtcatgtccactgctggaaaatga

DBGET integrated database retrieval system