KEGG   Macaca mulatta (rhesus monkey): 711995Help
Entry
711995            CDS       T01028                                 

Gene name
HKDC1
Definition
hexokinase domain containing 1
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    711995 (HKDC1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    711995 (HKDC1)
   00051 Fructose and mannose metabolism
    711995 (HKDC1)
   00052 Galactose metabolism
    711995 (HKDC1)
   00500 Starch and sucrose metabolism
    711995 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    711995 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    711995 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    711995 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    711995 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    711995 (HKDC1)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    711995 (HKDC1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     711995 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILAVVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQMFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGVDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFRLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLGIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGDEGKMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRTILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtccacttgatggcattttacttcagcaagctgaaggaggatcagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgatacccttttggacatcatg
aggcggttccgagcagagatggagaagggcttggcgaaggacacgaaccccacggccgcg
gtgaagatgctgcccaccttcgtcagggccattcctgatggttccgaaaatggggagttc
ctttccctggatctcggagggtccaagtttcgagtgctgaaggtgcaagtcgctgaagaa
gggaagcgacatgtgcagatggagagtcagttctacccaacacccaatgaaatcatccgt
gggaacggcacagagctgtttgaatatgtagcagactgtctggcagatttcatgaagacc
aaagatttaaagcataagaaattgccccttggcctaactttttctttcccctgccgacag
actaaactggaagagggtgtcctgctttcatggacaaagaagtttaaggcacgaggagtt
caggacacggatgtggtgagccgtctgaccaaagccatgaggagacacaaggacatggac
gtggacatcctggccgtggtcaatgacaccgtggggaccatgatgacctgtgcctatgac
gacccctactgcgaagttggtgtcatcatcggaacaggcacaaatgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgacgagggcaggatgtgcatcaacacagag
tggggggccttcggggacgatggggccctggaggacattcgcaccgagttcgacagggag
ctggacctcggctctctcaacccgggaaagcaaatgtttgagaagatgatcagtggcctg
tacctgggggagcttgtcaggcttatcttgctgaagatggccaaggctggcctcctgttc
ggcggtgagaaatcttctgctctccacactaagggcaagattgaaacacggcacgtggct
gccatggagaagtataaagaaggccttgccaatacaagagagatcctggtggacctgggc
ctggagccatctgaggctgactgcattgccgtccagcatgtctgtaccatcgtctccttc
cgctcagccaacctctgtgcagcagccctggcagccatcctgacacgcctccgggagaac
aagaaggtggaacggctccggaccacggtgggcgtggacggcaccctctacaagatccac
cctcagtacccaaaacgcctgcacaaggtggtgaggaaactggtcccgagctgtgatgtc
cgattcctcctgtcagagagtggcagcaccaagggggccgccatggtgactgcggtggcc
tcccgcgtgcaggcccagcggaagcagatcgacaaggtgctggctttgttccggctgacc
cgagagcagcttgtggacgtgcaggccaagatgcgggctgagctggagtatgggctgaag
aagaagagccacgggctggccacggtcagaatgctgcccacttacgtctgcgggctgccg
gacggcacagagaaaggaaagtttcttgccctggatcttgggggaaccaacttccgggtc
ctcctggtgaagatcagaagtggacggaggtcagtgcgaatgtacaacaagatcttcgcc
atccccctggggatcatgcagggcactggtgaggagctctttgaccacattgtgcagtgc
attgccgacttcctggactacatgggcctcaagggggcctccctacctttgggcttcacg
ttctcatttccctgcaggcagatgagcattgacaagggaacactcatagggtggaccaaa
ggtttcaaggccactgactgtgaaggggaggacgtggtggacatgctcagggaagccatc
aagaggagaaacgagtttgacctggacatcgttgcagttgtgaatgatacagtggggacc
atgatgacctgtggctatgaagatcctaactgtgagattggcttgattgcaggaacaggc
agcaacatgtgctacatggaggacatgaggaacatcgagatggtggagggggacgaaggg
aagatgtgcatcaacacagagtggggaggatttggagacaatggctgcatagatgacatc
cggacccgatacgacacggaggtggacgaggggtccttgaatcctggcaagcagagatac
gagaaaatgaccagtgggatgtacttgggggagattgtgcggcagatcctgatcgacctg
accaagcagggtctcctcttccgagggcagatttcagagcgtctccggaccaggggcatc
ttcgaaaccaagttcctgtcccagattgaaagcgatcggctggccctcctccaggtcagg
acgattctgcagcagctgggcctggacagcacatgtgaggacagcatcgtggtgaaggag
gtgtgcggagctgtgtcccggagggcggcccagctctgcggtgctggcctggccgctata
gtggaaaaaaggagagaagaccaggggctggagcacctgaggatcactgtgggtgtggat
ggcaccctgtacaagctgcaccctcacttttctagaatattgcaggaaactgtgaaggaa
ctagcccctcgatgtgatgtgacattcatgctgtcagaagatggcagtggaaaaggggca
gcactgatcactgctgtggccaagaggttacagcaggcacagaaggagaactag

DBGET integrated database retrieval system