KEGG   Macaca mulatta (rhesus monkey): 711995Help
Entry
711995            CDS       T01028                                 

Gene name
HKDC1
Definition
hexokinase domain containing 1
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Butirosin and neomycin biosynthesis
Metabolic pathways
Carbon metabolism
HIF-1 signaling pathway
Insulin signaling pathway
Type II diabetes mellitus
Carbohydrate digestion and absorption
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:mcc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mcc00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mcc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mcc00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis [PATH:mcc00524]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:mcc04066]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mcc04910]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:mcc04973]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:mcc04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVAEEGKRHVQMESQFYPTPNEIIR
GNGTELFEYVADCLADFMKTKDLKHKKLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSRLTKAMRRHKDMDVDILAVVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQMFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILVDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKVERLRTTVGVDGTLYKIH
PQYPKRLHKVVRKLVPSCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFRLT
REQLVDVQAKMRAELEYGLKKKSHGLATVRMLPTYVCGLPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLGIMQGTGEELFDHIVQCIADFLDYMGLKGASLPLGFT
FSFPCRQMSIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNMCYMEDMRNIEMVEGDEGKMCINTEWGGFGDNGCIDDI
RTRYDTEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRTILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLEHLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAQKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtccacttgatggcattttacttcagcaagctgaaggaggatcagatcaag
aaggtggacaggttcctgtatcacatgcggctctccgatgatacccttttggacatcatg
aggcggttccgagcagagatggagaagggcttggcgaaggacacgaaccccacggccgcg
gtgaagatgctgcccaccttcgtcagggccattcctgatggttccgaaaatggggagttc
ctttccctggatctcggagggtccaagtttcgagtgctgaaggtgcaagtcgctgaagaa
gggaagcgacatgtgcagatggagagtcagttctacccaacacccaatgaaatcatccgt
gggaacggcacagagctgtttgaatatgtagcagactgtctggcagatttcatgaagacc
aaagatttaaagcataagaaattgccccttggcctaactttttctttcccctgccgacag
actaaactggaagagggtgtcctgctttcatggacaaagaagtttaaggcacgaggagtt
caggacacggatgtggtgagccgtctgaccaaagccatgaggagacacaaggacatggac
gtggacatcctggccgtggtcaatgacaccgtggggaccatgatgacctgtgcctatgac
gacccctactgcgaagttggtgtcatcatcggaacaggcacaaatgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgacgagggcaggatgtgcatcaacacagag
tggggggccttcggggacgatggggccctggaggacattcgcaccgagttcgacagggag
ctggacctcggctctctcaacccgggaaagcaaatgtttgagaagatgatcagtggcctg
tacctgggggagcttgtcaggcttatcttgctgaagatggccaaggctggcctcctgttc
ggcggtgagaaatcttctgctctccacactaagggcaagattgaaacacggcacgtggct
gccatggagaagtataaagaaggccttgccaatacaagagagatcctggtggacctgggc
ctggagccatctgaggctgactgcattgccgtccagcatgtctgtaccatcgtctccttc
cgctcagccaacctctgtgcagcagccctggcagccatcctgacacgcctccgggagaac
aagaaggtggaacggctccggaccacggtgggcgtggacggcaccctctacaagatccac
cctcagtacccaaaacgcctgcacaaggtggtgaggaaactggtcccgagctgtgatgtc
cgattcctcctgtcagagagtggcagcaccaagggggccgccatggtgactgcggtggcc
tcccgcgtgcaggcccagcggaagcagatcgacaaggtgctggctttgttccggctgacc
cgagagcagcttgtggacgtgcaggccaagatgcgggctgagctggagtatgggctgaag
aagaagagccacgggctggccacggtcagaatgctgcccacttacgtctgcgggctgccg
gacggcacagagaaaggaaagtttcttgccctggatcttgggggaaccaacttccgggtc
ctcctggtgaagatcagaagtggacggaggtcagtgcgaatgtacaacaagatcttcgcc
atccccctggggatcatgcagggcactggtgaggagctctttgaccacattgtgcagtgc
attgccgacttcctggactacatgggcctcaagggggcctccctacctttgggcttcacg
ttctcatttccctgcaggcagatgagcattgacaagggaacactcatagggtggaccaaa
ggtttcaaggccactgactgtgaaggggaggacgtggtggacatgctcagggaagccatc
aagaggagaaacgagtttgacctggacatcgttgcagttgtgaatgatacagtggggacc
atgatgacctgtggctatgaagatcctaactgtgagattggcttgattgcaggaacaggc
agcaacatgtgctacatggaggacatgaggaacatcgagatggtggagggggacgaaggg
aagatgtgcatcaacacagagtggggaggatttggagacaatggctgcatagatgacatc
cggacccgatacgacacggaggtggacgaggggtccttgaatcctggcaagcagagatac
gagaaaatgaccagtgggatgtacttgggggagattgtgcggcagatcctgatcgacctg
accaagcagggtctcctcttccgagggcagatttcagagcgtctccggaccaggggcatc
ttcgaaaccaagttcctgtcccagattgaaagcgatcggctggccctcctccaggtcagg
acgattctgcagcagctgggcctggacagcacatgtgaggacagcatcgtggtgaaggag
gtgtgcggagctgtgtcccggagggcggcccagctctgcggtgctggcctggccgctata
gtggaaaaaaggagagaagaccaggggctggagcacctgaggatcactgtgggtgtggat
ggcaccctgtacaagctgcaccctcacttttctagaatattgcaggaaactgtgaaggaa
ctagcccctcgatgtgatgtgacattcatgctgtcagaagatggcagtggaaaaggggca
gcactgatcactgctgtggccaagaggttacagcaggcacagaaggagaactag

DBGET integrated database retrieval system