KEGG   Macaca mulatta (rhesus monkey): 712053Help
Entry
712053            CDS       T01028                                 

Gene name
G6PC
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00052  Galactose metabolism
mcc00500  Starch and sucrose metabolism
mcc01100  Metabolic pathways
mcc04068  FoxO signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04152  AMPK signaling pathway
mcc04910  Insulin signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04922  Glucagon signaling pathway
mcc04931  Insulin resistance
mcc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    712053 (G6PC)
   00052 Galactose metabolism
    712053 (G6PC)
   00500 Starch and sucrose metabolism
    712053 (G6PC)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    712053 (G6PC)
   04151 PI3K-Akt signaling pathway
    712053 (G6PC)
   04152 AMPK signaling pathway
    712053 (G6PC)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    712053 (G6PC)
   04922 Glucagon signaling pathway
    712053 (G6PC)
   04920 Adipocytokine signaling pathway
    712053 (G6PC)
  Digestive system
   04973 Carbohydrate digestion and absorption
    712053 (G6PC)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    712053 (G6PC)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     712053 (G6PC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 712053
NCBI-ProteinID: XP_001112333
Ensembl: ENSMMUG00000008087
UniProt: F7GZ83
Position
16
AA seq 357 aa AA seqDB search
MEEGMNVLHDFGIQSTHYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLQEAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTNYYGNTSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFRGKKKPTYRFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFSHIHSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK
AQRWCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLGKWLPFRLSSIV
ASLVLLHLFDSLKPPSQVELVFYVLSFCKSAVVPLASVSVIPYCLAQILGQPHKKSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggaatgaatgttctccatgactttgggatccagtcaacacactacctccag
gtgaattaccaagactcccaggactggttcatcttggtgtccgtgattgcagacctcagg
aatgccttctacgtcctcttccccatctggttccatcttcaggaagctgtgggcattaaa
ctcctctgggtagcggtgattggagactggctcaacctcgtctttaagtggattctcttt
ggacagcgtccatactggtgggttttggacaccaactactacggcaacacttctgtgccc
ctgataaagcagttccctgtcacctgtgagactggaccagggagcccctctggccatgcc
atgggtacagcaggtgtatactacgtgatggtcacatctactctttccatctttcgggga
aagaaaaagccgacctacagatttcggtgcttgaatgtcattttgtggttgggattctgg
gctgtgcagctgaacgtctgtctgtcacgaatctaccttgctgctcattttcctcatcaa
gttgttgccggagtcctgtcaggcattgctgttgcagaaactttcagccacatccacagc
atctataatgccagtctcaagaaatattttctcattaccttcttcctgttcagcttcgcc
atcggattttatctgctgctcaagggactgggtgtagacctcctatggactctggagaaa
gcccagaggtggtgcgagcggccagaatgggtccacattgacaccacgccctttgccagc
ctcctcaagaacctgggcaccctctttggcctggggctggctctcaactccagcatgtac
agggaaagctgcaaggggaaactcggcaagtggctcccattccgcctcagctctattgta
gcctccctcgtcctcctgcacctctttgactccttgaaacccccgtcccaagtcgagctg
gtcttctacgtcttgtccttctgcaagagtgcggtagtgcccctggcatccgtcagtgtc
atcccctactgcctcgcccagatcctgggccagccacacaagaagtcattgtaa

DBGET integrated database retrieval system