KEGG   Macaca mulatta (rhesus monkey): 712098Help
Entry
712098            CDS       T01028                                 

Gene name
USP22
Definition
(RefSeq) ubiquitin specific peptidase 22
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     712098 (USP22)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   712098 (USP22)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     712098 (USP22)
Ubiquitin system [BR:mcc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    712098 (USP22)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     712098 (USP22)
    SLIK complex
     712098 (USP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 525 aa AA seqDB search
MVSRPEPEGEAMDAELAVAPPGCSHLGSFKVDNWKQNLRAIYQCFVWSGTAEARKRKAKS
CICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKSKRHNLAIDLMYGGIYCFLCQDYIY
DKDMEIIAKEEQRKAWKMQGAGEKFSTWEPTKRELELLKHNPKRRKITSNCTIGLRGLIN
LGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHRSPHI
PYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQI
FTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSEGNVVNGESHVSGTT
TLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRR
KITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHY
TSFIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcccggccagagcccgagggcgaggccatggacgccgagctggctgtagcgccg
ccgggctgctcgcacttgggcagcttcaaagtggacaactggaagcagaacctgcgggcc
atctaccagtgcttcgtgtggagcggcacggctgaggcccgcaagcgcaaggccaagtcc
tgcatctgccatgtctgtggcgtccacctcaacaggctgcattcctgcctctactgcgtc
ttcttcggctgtttcacgaagaagcacattcacgagcatgcgaagtcaaagcggcacaac
ctggccattgatctgatgtacggaggcatctactgctttctgtgccaggactacatctac
gacaaagacatggaaataatcgccaaggaggagcagcggaaggcttggaaaatgcaaggc
gctggagagaagttttcaacttgggaaccaaccaaacgggagcttgaactgctgaagcac
aacccaaaaaggagaaagatcacctcgaactgcaccataggtctgcgcgggctcatcaac
cttgggaacacgtgcttcatgaactgcatcgtgcaggcgctgacccacacgccacttctg
cgggacttcttcctgtctgacaggcaccgctgtgagatgcagagccccagctcctgtctg
gtctgtgagatgtcctcactgtttcaggagttttactccggacaccggtcccctcacatc
ccttataagttgctgcacctggtgtggacccacgcgaggcacctggcaggctacgagcag
caggatgcccacgagttcctcatcgcagccctggacgtgctccaccgacactgcaaaggt
gatgacaacgggaagaaggccaacaaccccaaccactgcaactgcatcatagaccagatc
ttcacgggcgggctgcagtcagacgtcacctgccaagtttgccatggagtctccaccacc
atcgaccccttctgggacatcagcttggatctccccggctcttccaccccgttctggccc
ctgagcccagggagcgagggcaacgtggtaaacggggaaagccacgtgtcgggaaccacc
acgctcacggactgcctgcgacgattcaccagaccagagcacttgggcagcagcgccaag
atcaaatgcagcggttgccatagctaccaggagtccacgaagcagctcactatgaagaaa
ctgcccatcgtagcctgttttcatctcaaacgatttgaacactcagccaagctgcggcgg
aagatcaccacatatgtgtccttccccctggagctggatatgacccctttcatggcctcc
agcaaagagagcaggatgaatggacagtaccagcagcccacggacagtctcaacaatgac
aacaagtattccctgtttgctgttgttaaccatcaagggaccttggagagtggccattac
accagctttatccggcagcacaaagaccagtggttcaagtgtgacgatgccatcatcacc
aaggccagcatcaaggacgtgctggacagtgaagggtacttgctgttctatcacaaacag
ttcctggaatatgagtag

DBGET integrated database retrieval system