KEGG   Macaca mulatta (rhesus monkey): 712291Help
Entry
712291            CDS       T01028                                 

Definition
DNA repair protein XRCC4-like
Orthology
K10886  
DNA-repair protein XRCC4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:mcc03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 334 aa AA seqDB search
MERKISRIHLTSEPNIAHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMA
MEKGKYVDELRKALVSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPA
EVIRELICYCLDTIAENEAKNEHLQKENERLLRDWNDVQGRFEKCVNAKEALETDLYKRF
ILVLNEKKTKIRSLHNKLLNTAQEQEKDIKQEGETTICSEMTADRDPVYDESTDEENENQ
PDPSGSASAAVSKDDSIISSLDVIDIAPSRKRRQRMQKNLGTEPKMAPQEHQFQEKEKPD
SSLPETSKKEHISAENMSLETLRNSSPEDLFDEI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaaataagcagaatccatcttacttctgaacccaatattgctcattttcta
caagtatcttgggagaaaacactggaatctggttttgttattacacttactgatggtcat
tcagcatggactgggacagtttctgaatcagagatttcccaagaagctgatgacatggca
atggaaaaagggaaatatgttgatgaactgagaaaagcattggtgtcaggagcaggacca
gctgatgtatacacatttaatttttctaaagagtcttgttatttcttctttgagaaaaac
ctgaaagatgtttcattcagacttggttccttcaacctagagaaagttgaaaacccagct
gaagtcattagagaacttatttgttattgcttggacaccatcgcagaaaatgaagccaaa
aatgagcacctgcagaaagaaaatgaaaggcttctgagagattggaatgatgttcaagga
cgatttgaaaaatgtgtgaacgctaaggaagctttggagactgatctttataagcggttt
attctggtgttgaatgagaagaaaacaaaaatcagaagtttgcataataaattattaaat
acagctcaagaacaagaaaaggacatcaaacaagaaggggaaactacaatctgttctgaa
atgactgctgaccgagatccagtctatgatgagagtactgatgaggaaaatgaaaaccaa
cctgatccctctgggtcggcttcagctgctgtaagtaaagatgattccattatttcaagt
cttgatgtcattgatattgcgccaagtagaaaaaggagacagcgaatgcaaaagaatctt
gggacagaacctaaaatggctcctcaggagcatcagtttcaagaaaaggaaaagcctgat
tcttcactacctgagacatcgaaaaaggagcacatctcagctgaaaacatgtctttagaa
actctgagaaacagcagcccagaagacctctttgatgagatttaa

DBGET integrated database retrieval system