KEGG   Macaca mulatta (rhesus monkey): 712370Help
Entry
712370            CDS       T01028                                 

Gene name
MGEA5
Definition
meningioma expressed antigen 5 (hyaluronidase)
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 644 aa AA seqDB search
MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
LCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEAEQLM
TLISAAREYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDIDHNM
CAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTGPKVVSKEIPVESIEEVSKIIKR
APVIWDNIHANDYDQKRLFLGPYKGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYK
SNMNGVRKDVVMTDSEDSTVSIQIKLENEGSDEDIETDVLYSPQMALKLALTEWLQEFGV
PHQYSSRQVAHSGAKASVVDGTPLVAAPSLNATTVVTTVYQEPIMSQGAALSGEPTTLTK
EEEKKQPDEEPMDMVVEKQEETDHKNDSQILSEIVEAKMAEELKPMDTDKESIAESKSPE
MSMQEDCISDIAPMQTDEQTNKEQFVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGP
KGAQMLREFQWLRANSSVVSVNCKGKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCAN
RTILYDMYSYVWDIKSIMSMVKSFVQWLGRCTRNNLFSSNILSL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaggagagtcaagcgacgctggaggagcgggagagcgagctcagctccaac
cctgccgcctctgcgggggcatcgctggagccgccggcagctccggcacccggagaagac
aaccccgccggggctgggggagcggcggtggctggggctgcaggaggggctcggcggttc
ctgtgtggcgtggtggaaggattttacggaagaccttgggttatggaacagagaaaagaa
ctctttagaaggctccagaaatgggaattaaatacatacttgtatgccccaaaagatgac
tacaaacataggatgttttggcgagagatgtattcagtggaggaagctgagcaacttatg
actctcatctctgctgcacgagaatatgagatagagttcatctacgcgatctcacctgga
ttggatatcactttttctaaccccaaggaagtatccacattgaaacgtaaattggaccag
gtttctcagtttgggtgcaggtcatttgctttgctttttgatgatatagaccataatatg
tgtgcagcagacaaagaggtattcagttcttttgctcatgcccaggtctccatcacaaat
gaaatctatcagtacctaggagagccagaaactttcctcttctgtcccacaggtcccaaa
gttgtttctaaagaaattccggtagagtccattgaagaagtgtctaagattattaagaga
gcgccagtaatttgggataacattcatgctaatgattatgatcagaagagactgtttctg
ggcccgtacaaaggaagatccacagaactcatcccacggttaaaaggagtcctgactaat
ccaaattgtgaatttgaagccaactatgttgctatccacacccttgccacctggtacaaa
tcaaacatgaacggagtgagaaaagatgtagtgatgactgacagtgaagatagtactgta
tccatccaaataaagttagaaaatgaaggcagtgatgaagatattgaaactgatgtactc
tatagtccacagatggctctaaagctagctttaacagaatggttgcaagaatttggtgtg
cctcatcagtacagcagtaggcaagttgcacacagtggagctaaagcaagtgtagttgat
gggactcctttagttgcagcaccttctttaaatgccacaaccgtagtaacaacagtttat
caggagcccattatgagccaaggagcagccttgagtggtgagcctactactctgaccaag
gaagaagaaaagaaacagcctgatgaagaacccatggacatggtggtggaaaaacaagaa
gaaacggaccacaagaatgacagtcaaatactgagtgaaattgttgaagcgaaaatggca
gaggaattgaaaccaatggacactgataaagagagcatagctgaatcaaaatccccagag
atgtccatgcaagaagattgtattagtgacattgcccctatgcagactgatgaacagacg
aacaaggagcagtttgtgccaggtccaaatgaaaaacctttatacactgcagaaccagtg
accctggaggatttgcagttacttgctgatctattctacctaccttatgagcatggaccc
aaaggagcacagatgttacgggaatttcagtggcttcgagcaaatagtagtgttgtcagt
gtcaactgcaaaggaaaagactctgaaaaaattgaagaatggcggtcacgagcagccaag
tttgaagagatgtgtggactagtgatgggaatgttcactcggctgtccaattgtgccaac
aggacaatcctttatgacatgtactcctatgtttgggatatcaagagtataatgtctatg
gtgaagtcttttgtacagtggttaggtaggtgtaccaggaataatctcttctcctcaaat
atattgtccctttaa

DBGET integrated database retrieval system