KEGG   Macaca mulatta (rhesus monkey): 712473Help
Entry
712473            CDS       T01028                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     712473
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   712473
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 383 aa AA seqDB search
MSLGWLERPRALRRAAGDGARRLSGSRRGDVWWTSSAAGLLRSVAGCSWCGGRPRARGGS
GRCVAGAMTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLI
FLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSE
FKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNG
RLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQ
KIAELQRQLAEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLP
FIMELLKTLAEHQQLIPLVEKGK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgtctctagggtggctagagcgtcctcgcgcgctccgtcgcgctgcaggtgacggcgcc
cggaggctgtcgggaagtaggcggggtgacgtgtggtggacgagctcggcggcgggtttg
ctgagatctgtggctggctgcagctggtgcggggggcggccgagagcgagaggtggatcg
gggcggtgtgtggccggggccatgacgggcaatgccggggagtggtgcctcatggaaagc
gaccccggggtcttcaccgagctcattaaaggattcggttgccgaggagcccaagtagaa
gaaatatggagtttagagcctgagaattttgaaaaattaaagccagttcatgggttaatt
tttcttttcaagtggcagccaggagaagaaccagcaggctctgtggttcaggactcccga
cttgacacgatattttttgctaagcaggtaattaataatgcttgtgctactcaagccata
gtgagtgtgttactgaactgtacccaccaggatgtccatttaggcgagacattatcagag
tttaaagaattttcacaaagttttgatgcagctatgaaaggcttggcactgagcaattca
gatgtgattcgacaagtacacaacagtttcgccagacagcaaatgtttgaatttgatacg
aagacatcagcaaaagaagaagatgcttttcattttgtcagttatgttcctgttaatgga
agactgtatgaattagatggattaagagaaggaccgattgatttaggtgcatgcaatcaa
gatgattggatcagtgcagtaaggcctgtcatagaaaaaaggatacaaaagtacagtgaa
ggtgaaattcgatttaatttaatggccattgtgtctgacagaaaaatgatatatgaacag
aagatagcagagttacaacgacaacttgcagaggaacccatggatacagatcaaggtaat
agtatgttaagtgctattcagtcagaagttgccaaaaatcagatgcttattgaagaagaa
gtacagaaattaaaaagatacaagattgagaatatcagaaggaagcataattatctgcct
ttcattatggaattgttaaagactttagcagaacaccagcagttaataccactagtagaa
aagggaaaatag

DBGET integrated database retrieval system