KEGG   Macaca mulatta (rhesus monkey): 712509Help
Entry
712509            CDS       T01028                                 

Gene name
ADRA1A
Definition
adrenoceptor alpha 1A
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:mcc04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:mcc04080]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:mcc04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mcc04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:mcc04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 466 aa AA seqDB search
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGVASTKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
IKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRRQSSKHALGYTL
HPPSQALEGQHKDTVRIPVGSGETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctccggaaatgcttccgacagctccaactgcacccaaccgccggcaccg
gtgaacatttccaaggccattctgctcggggtgatcttggggggcctcattcttttcggg
gtgctggggaacatcctagtgatcctctccgtagcctgtcaccgacacctgcactcagtc
acacactactacatcgtcaacctggcggtggccgacctcctgctcacctccacggtgctg
cccttctccgccatcttcgaggtcctaggctactgggcctttggcagagtcttctgcaac
atctgggcggcagtggatgttctgtgctgcaccgcgtccatcatgggcctctgcatcatc
tccatcgaccgctacatcggcgtgagctacccgctgcgctacccaaccatcgtcacccag
aggaggggtctcatggctctgctctgcgtctgggcactctccctggtcatctccatcgga
cccctgttcggctggaggcagccggcccccgaggacgagaccatctgtcagatcaatgag
gagccgggctacgtgctcttctcagcgctgggctccttctacctgccgctggccatcatt
ttggtcatgtactgccgcgtctacgtggtggccaagagggagagccggggcctcaagtct
ggcctcaagaccgacaagtcggactcggagcaagtgacgctccgcatccatcggaaaaac
gcccctgcaggaggcagcggggtggccagcaccaagaccaagacgcacttctcggtgagg
ctcctcaagttctcccgggagaagaaagcggccaaaacgctgggcatcgtggtgggctgc
ttcgtcctctgctggctaccttttttcttagtgatgcccattgggtctttcttccctgat
atcaagccctctgaaacagtttttaaaatagtattttggctcggatatctaaacagctgc
atcaaccccatcatatacccatgttccagccaagagttcaaaaaggcctttcagaacgtc
ttgagaatccagtgtctccgcagaaggcagtcttccaaacatgccctgggctacaccctg
cacccgcccagtcaggccctggaagggcagcacaaggacacggtgcgcatccccgtggga
tcaggagagaccttctacaggatctccaagacagatggcgtttgtgaatggaaatttttc
tcttccatgccccgtggatctgccaggattacagtgtccaaagaccaatcctcctgcacc
acagcccgggtgagaagtaaaagctttttgcaggtctgctgctgtgtagggccctcaacc
cccagccttgacaagaaccatcaagttccaaccattaaggtccacaccatctccctcagt
gagaacggggaggaagtctag

DBGET integrated database retrieval system